Metal transporter CNNM4 (Cnnm4) Recombinant Protein | Cnnm4 recombinant protein
Recombinant Mouse Metal transporter CNNM4 (Cnnm4)
Gene Names
Cnnm4; Acdp4; 5430430O18Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metal transporter CNNM4 (Cnnm4); Recombinant Mouse Metal transporter CNNM4 (Cnnm4); Cnnm4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-771aa; full length protein
Sequence
MAPGGGGGRRDGWPARGRLLLAALLLLWTRAASGQSSPQQSVILGMRLASCNKSCGMNPD GIIFVSEGSTVNLRLYGHSLGDISSNLISFTEVDDAEAVHNSTNCLELTKDLVVQRLVNV SRGNTSGMLVVITKFLRRSENMKLYALCTRPRADGPWTRWTDKDSLLFMVEEHGRFLPLW LHILLVMVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERKYARKIEPIRRKGNYLL CSLLLGNVLVNTSLTILLDNLIGSGIMAVASSTIGIVIFGEILPQALCSRHGLAVGANTI VLTKVFMLLTFPLSFPISKLLDFVLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELNMIQ GALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILY VKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNNEGE GDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRTRKRVSVKNKRDFSAFKDTDNELK VKISPQLLLAAHRFLATEVPQFSPSLMSEKILLRLLKYPDVIQELRFNEHNRYCVRHYLY TRNKPADCFVLILQGKVEVEAGKENMKFETGAFSYYGTMALSVAPPDRSPALPTPLSRSA SLSYPDRNTDLTSTSLAGSNQFGSCILGQYVSDFSVRALTDLQYIKITRQQYQNGLMASR MDNSPQPTFDGCATCSENFMERPELPPVDETTTLLNERNSLLHRASEEETI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cnnm4 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86,626 Da
NCBI Official Full Name
metal transporter CNNM4
NCBI Official Synonym Full Names
cyclin M4
NCBI Official Symbol
Cnnm4
NCBI Official Synonym Symbols
Acdp4; 5430430O18Rik
NCBI Protein Information
metal transporter CNNM4
UniProt Protein Name
Metal transporter CNNM4
Protein Family
UniProt Gene Name
Cnnm4
UniProt Synonym Gene Names
Acdp4; Kiaa1592; mACDP4
UniProt Entry Name
CNNM4_MOUSE
Uniprot Description
CNNM4: Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions. May play a role in biomineralization and retinal function. Defects in CNNM4 are the cause of Jalili syndrome (JALIS). A syndrome characterized by the association of cone- rod dystrophy and amelogenesis imperfecta. Belongs to the ACDP family.
Protein type: Membrane protein, integral; Cell cycle regulation; Membrane protein, multi-pass
Cellular Component: basolateral plasma membrane; integral to membrane; membrane; plasma membrane
Molecular Function: magnesium ion transmembrane transporter activity; sodium ion transmembrane transporter activity
Biological Process: biomineral formation; ion transport; magnesium ion transport; response to stimulus; transport; visual perception
Research Articles on Cnnm4
Similar Products
Product Notes
The Cnnm4 cnnm4 (Catalog #AAA7011887) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-771aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cnnm4 cnnm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPGGGGGRR DGWPARGRLL LAALLLLWTR AASGQSSPQQ SVILGMRLAS CNKSCGMNPD GIIFVSEGST VNLRLYGHSL GDISSNLISF TEVDDAEAVH NSTNCLELTK DLVVQRLVNV SRGNTSGMLV VITKFLRRSE NMKLYALCTR PRADGPWTRW TDKDSLLFMV EEHGRFLPLW LHILLVMVLL VLSGIFSGLN LGLMALDPME LRIVQNCGTE KERKYARKIE PIRRKGNYLL CSLLLGNVLV NTSLTILLDN LIGSGIMAVA SSTIGIVIFG EILPQALCSR HGLAVGANTI VLTKVFMLLT FPLSFPISKL LDFVLGQEIR TVYNREKLME MLKVTEPYND LVKEELNMIQ GALELRTKTV EDIMTQLHDC FMIRSDAILD FNTMSEIMES GYTRIPVFED EQSNIVDILY VKDLAFVDPD DCTPLKTITR FYNHPVHFVF HDTKLDAMLE EFKKGKSHLA IVQKVNNEGE GDPFYEVLGL VTLEDVIEEI IKSEILDESD MYTDNRTRKR VSVKNKRDFS AFKDTDNELK VKISPQLLLA AHRFLATEVP QFSPSLMSEK ILLRLLKYPD VIQELRFNEH NRYCVRHYLY TRNKPADCFV LILQGKVEVE AGKENMKFET GAFSYYGTMA LSVAPPDRSP ALPTPLSRSA SLSYPDRNTD LTSTSLAGSN QFGSCILGQY VSDFSVRALT DLQYIKITRQ QYQNGLMASR MDNSPQPTFD GCATCSENFM ERPELPPVDE TTTLLNERNS LLHRASEEET I. It is sometimes possible for the material contained within the vial of "Metal transporter CNNM4 (Cnnm4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
