Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein cornichon homolog 2 (Cnih2) Recombinant Protein | Cnih2 recombinant protein

Recombinant Mouse Protein cornichon homolog 2 (Cnih2)

Gene Names
Cnih2; Cnil
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein cornichon homolog 2 (Cnih2); Recombinant Mouse Protein cornichon homolog 2 (Cnih2); Recombinant Protein cornichon homolog 2 (Cnih2); Protein cornichon homolog 2; Cornichon-like protein; Cnih2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-160
Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
Sequence Length
160
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,931 Da
NCBI Official Full Name
protein cornichon homolog 2
NCBI Official Synonym Full Names
cornichon homolog 2 (Drosophila)
NCBI Official Symbol
Cnih2
NCBI Official Synonym Symbols
Cnil
NCBI Protein Information
protein cornichon homolog 2; cornichon-like protein
UniProt Protein Name
Protein cornichon homolog 2
Protein Family
UniProt Gene Name
Cnih2
UniProt Synonym Gene Names
Cnil
UniProt Entry Name
CNIH2_MOUSE

NCBI Description

This gene encodes a protein that is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. This protein is similar to a Drosophila protein involved in anterior-posterior and dorsal-ventral patterning. Cnih2 conditional knockout mice exhibit reduced AMPA receptor synaptic transmission in the hippocampus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Uniprot Description

CNIH2: Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization. Blocks CACNG8-mediated resensitization of AMPA receptors. Belongs to the cornichon family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: postsynaptic membrane; cell projection; membrane; endoplasmic reticulum; dendrite; postsynaptic density; dendritic spine; plasma membrane; integral to membrane; synapse; dendritic shaft; cell junction

Molecular Function: channel regulator activity

Biological Process: synaptic transmission, glutamatergic; localization within membrane; regulation of membrane potential

Research Articles on Cnih2

Similar Products

Product Notes

The Cnih2 cnih2 (Catalog #AAA1187313) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-160. The amino acid sequence is listed below: MAFTFAAFCY MLTLVLCASL IFFVIWHIIA FDELRTDFKN PIDQGNPARA RERLKNIERI CCLLRKLVVP EYSIHGLFCL MFLCAAEWVT LGLNIPLLFY HLWRYFHRPA DGSEVMYDAV SIMNADILNY CQKESWCKLA FYLLSFFYYL YSMVYTLVSF. It is sometimes possible for the material contained within the vial of "Protein cornichon homolog 2 (Cnih2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.