Putative cyclic nucleotide-gated ion channel 18 (CNGC18) Recombinant Protein | CNGC18 recombinant protein
Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 18 (CNGC18)
Gene Names
CNGC18; ATCNGC18; CNGC18; cyclic nucleotide-gated channel 18; CYCLIC NUCLEOTIDE-GATED CHANNEL 18; T9L3.170; T9L3_170
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative cyclic nucleotide-gated ion channel 18 (CNGC18); Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 18 (CNGC18); CNGC18 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-706aa; full length protein
Sequence
MNKIRSLRCLLPETITSASTAASNRGSDGSQFSVLWRHQILDPDSNIVTYWNHVFLITSI LALFLDPFYFYVPYVGGPACLSIDISLAATVTFFRTVADIFHLLHIFMKFRTAFVARSSR VFGRGELVMDSREIAMRYLKTDFLIDVAAMLPLPQLVIWLVIPAATNGTANHANSTLALI VLVQYIPRSFIIFPLNQRIIKTTGFIAKTAWAGAAYNLLLYILASHVLGAMWYLSSIGRQ FSCWSNVCKKDNALRVLDCLPSFLDCKSLEQPERQYWQNVTQVLSHCDATSSTTNFKFGM FAEAFTTQVATTDFVSKYLYCLWWGLRNLSSYGQNITTSVYLGETLFCITICIFGLILFT LLIGNMQSSLQSMSVRVEEWRVKRRDTEEWMRHRQLPPELQERVRRFVQYKWLATRGVDE ESILHSLPTDLRREIQRHLCLSLVRRVPFFSQMDDQLLDAICGCLVSSLSTAGTYIFREG DPVNEMLFVIRGQIESSTTNGGRSGFFNSTTLRPGDFCGEELLTWALMPNSTLNLPSSTR SVRALSEVEAFALSAEDLKFVAHQFKRLQSKKLQHAFRYYSHQWRAWGACFVQSAWRRYK RRKLAKELSLHESSGYYYPDETGYNEEDEETREYYYGSDEEGGSMDNTNLGATILASKFA ANTRRGTNQKASSSSTGKKDGSSTSLKMPQLFKPDEPDFSIDKEDV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CNGC18 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,364 Da
NCBI Official Full Name
cyclic nucleotide-gated channel 18
NCBI Official Symbol
CNGC18
NCBI Official Synonym Symbols
ATCNGC18; CNGC18; cyclic nucleotide-gated channel 18; CYCLIC NUCLEOTIDE-GATED CHANNEL 18; T9L3.170; T9L3_170
NCBI Protein Information
cyclic nucleotide-gated channel 18
UniProt Protein Name
Putative cyclic nucleotide-gated ion channel 18
Protein Family
UniProt Gene Name
CNGC18
UniProt Entry Name
CNG18_ARATH
Uniprot Description
Cyclic nucleotide-gated ion channel required for directional pollen tube growth into the transmitting tract (PubMed:17726111, PubMed:26929345). Acts as a Ca2+-permeable divalent cation-selective channel inhibited by either lanthanum or gadolinium (PubMed:24380879). Regulated by CPK32 to mediate Ca2+ transport across the plasma membrane in response to Ca2+ oscillation (PubMed:24121288).
Research Articles on CNGC18
Similar Products
Product Notes
The CNGC18 cngc18 (Catalog #AAA7011850) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-706aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CNGC18 cngc18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNKIRSLRCL LPETITSAST AASNRGSDGS QFSVLWRHQI LDPDSNIVTY WNHVFLITSI LALFLDPFYF YVPYVGGPAC LSIDISLAAT VTFFRTVADI FHLLHIFMKF RTAFVARSSR VFGRGELVMD SREIAMRYLK TDFLIDVAAM LPLPQLVIWL VIPAATNGTA NHANSTLALI VLVQYIPRSF IIFPLNQRII KTTGFIAKTA WAGAAYNLLL YILASHVLGA MWYLSSIGRQ FSCWSNVCKK DNALRVLDCL PSFLDCKSLE QPERQYWQNV TQVLSHCDAT SSTTNFKFGM FAEAFTTQVA TTDFVSKYLY CLWWGLRNLS SYGQNITTSV YLGETLFCIT ICIFGLILFT LLIGNMQSSL QSMSVRVEEW RVKRRDTEEW MRHRQLPPEL QERVRRFVQY KWLATRGVDE ESILHSLPTD LRREIQRHLC LSLVRRVPFF SQMDDQLLDA ICGCLVSSLS TAGTYIFREG DPVNEMLFVI RGQIESSTTN GGRSGFFNST TLRPGDFCGE ELLTWALMPN STLNLPSSTR SVRALSEVEA FALSAEDLKF VAHQFKRLQS KKLQHAFRYY SHQWRAWGAC FVQSAWRRYK RRKLAKELSL HESSGYYYPD ETGYNEEDEE TREYYYGSDE EGGSMDNTNL GATILASKFA ANTRRGTNQK ASSSSTGKKD GSSTSLKMPQ LFKPDEPDFS IDKEDV. It is sometimes possible for the material contained within the vial of "Putative cyclic nucleotide-gated ion channel 18 (CNGC18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
