Citrate lyase subunit beta-like protein, mitochondrial (Clybl) Recombinant Protein | Clybl recombinant protein
Recombinant Rat Citrate lyase subunit beta-like protein, mitochondrial (Clybl)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Citrate lyase subunit beta-like protein; mitochondrial (Clybl); Recombinant Rat Citrate lyase subunit beta-like protein; Clybl recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-338, full length protein
Sequence
ASLVASVCRPGYSSLSNHKYVPRRAVLYVPGNDEKKIRKIPSLKVDCAVLDCEDGVAENKKNEARLRIAKTLEDFDLGTTEKCVRINSVSSGLAEADLETFLQARVLPSSLMLPKVEGPEEIQWFSDKFSLHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKIGPQVGLFLDAVVFGGEDFRASIGATSNKDTQDILYARQKIVVTAKAFGLQAIDLVYIDFRDEDGLLRQSREAAAMGFTGKQVIHPNQIAVVQEQFTPTPEKIRWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNIVTLATSIKEK
Sequence Length
318
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,322 Da
NCBI Official Full Name
citramalyl-CoA lyase, mitochondrial
NCBI Official Synonym Full Names
citrate lyase beta like
NCBI Official Symbol
Clybl
NCBI Protein Information
citramalyl-CoA lyase, mitochondrial; citrate lyase subunit beta-like protein, mitochondrial
UniProt Protein Name
Citramalyl-CoA lyase, mitochondrial
UniProt Gene Name
Clybl
UniProt Synonym Gene Names
Citrate lyase beta-like
Uniprot Description
Mitochondrial citramalyl-CoA lyase indirectly involved in the vitamin B12 metabolism. Converts citramalyl-CoA into acetyl-CoA and pyruvate in the C5-dicarboxylate catabolism pathway. The C5-dicarboxylate catabolism pathway is required to detoxify itaconate, a vitamin B12-poisoning metabolite. Also acts as a malate synthase in vitro, converting glyoxylate and acetyl-CoA to malate. Also acts as a beta-methylmalate synthase in vitro, by mediating conversion of glyoxylate and propionyl-CoA to beta-methylmalate. Also has very weak citramalate synthase activity in vitro.
Similar Products
Product Notes
The Clybl clybl (Catalog #AAA1319498) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-338, full length protein. The amino acid sequence is listed below: ASLVASVCRP GYSSLSNHKY VPRRAVLYVP GNDEKKIRKI PSLKVDCAVL DCEDGVAENK KNEARLRIAK TLEDFDLGTT EKCVRINSVS SGLAEADLET FLQARVLPSS LMLPKVEGPE EIQWFSDKFS LHLKGRKLEQ PMNLIPFVET AMGLLNFKAV CEETLKIGPQ VGLFLDAVVF GGEDFRASIG ATSNKDTQDI LYARQKIVVT AKAFGLQAID LVYIDFRDED GLLRQSREAA AMGFTGKQVI HPNQIAVVQE QFTPTPEKIR WAEELIAAFK EHQQLGKGAF TFQGSMIDMP LLKQAQNIVT LATSIKEK. It is sometimes possible for the material contained within the vial of "Citrate lyase subunit beta-like protein, mitochondrial (Clybl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
