Colipase (Clps) Recombinant Protein | Clps recombinant protein

Recombinant Mouse Colipase (Clps)

Cat. Num. AAA1402188

• Gene Names: Clps; 2200003J09Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Colipase (Clps); Recombinant Mouse Colipase (Clps); Clps recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-113, full length protein
• Sequence: GLIINLEDGEICLNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGICLDSRRSKQ
• Sequence Length: 90

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Clps recombinant protein

This protein is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements.

NCBI and Uniprot Product Information

• NCBI GI #: 951233384
• NCBI GeneID: 109791
• NCBI Accession #: NP_001303994.1
• NCBI GenBank Nucleotide #: NM_001317065.1
• UniProt Accession #: Q9CQC2; Q8VHR2; Q8VHR3
• Molecular Weight: 12,445 Da
• NCBI Official Full Name: colipase isoform 2
• NCBI Official Synonym Full Names: colipase, pancreatic
• NCBI Official Symbol: Clps
• NCBI Official Synonym Symbols: 2200003J09Rik
• NCBI Protein Information: colipase
• UniProt Protein Name: Colipase
• Protein Family: Colipase
• UniProt Gene Name: Clps

NCBI Description

This gene encodes a member of the colipase family of coenzymes that is required for the optimal activity of pancreatic lipase. The encoded protein undergoes proteolytic processing to generate a mature polypeptide that binds to the lipase and prevents inhibition by bile acids. Over half of the mice lacking the encoded protein die within two weeks of birth while the remaining ones exhibit fat malabsorption and altered body weight regulation. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015]

Uniprot Description

Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase.Enterostatin has a biological activity as a satiety signal.