Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial (Clpp) Recombinant Protein | Clpp recombinant protein
Recombinant Mouse Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial (Clpp)
Gene Names
Clpp; AU019820; D17Wsu160e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative ATP-dependent Clp protease proteolytic subunit; mitochondrial (Clpp); Recombinant Mouse Putative ATP-dependent Clp protease proteolytic subunit; Clpp recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
53-272, Full length protein
Sequence
PLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGSPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPELVQKETATAPTDPPAPTST
Sequence Length
220
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Clpp recombinant protein
This protein belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,800 Da
NCBI Official Full Name
ATP-dependent Clp protease proteolytic subunit, mitochondrial
NCBI Official Synonym Full Names
caseinolytic mitochondrial matrix peptidase proteolytic subunit
NCBI Official Symbol
Clpp
NCBI Official Synonym Symbols
AU019820; D17Wsu160e
NCBI Protein Information
ATP-dependent Clp protease proteolytic subunit, mitochondrial
UniProt Protein Name
ATP-dependent Clp protease proteolytic subunit, mitochondrial
Protein Family
UniProt Gene Name
Clpp
Uniprot Description
Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates ().
Research Articles on Clpp
Similar Products
Product Notes
The Clpp clpp (Catalog #AAA1256516) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 53-272, Full length protein. The amino acid sequence is listed below: PLIPIVVEQT GRGERAYDIY SRLLRERIVC VMGPIDDSVA SLVIAQLLFL QSESNKKPIH MYINSPGGVV TAGLAIYDTM QYILNPICTW CVGQAASMGS LLLAAGSPGM RHSLPNSRIM IHQPSGGARG QATDIAIQAE EIMKLKKQLY NIYAKHTKQS LQVIESAMER DRYMSPMEAQ EFGILDKVLV HPPQDGEDEP ELVQKETATA PTDPPAPTST. It is sometimes possible for the material contained within the vial of "Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial (Clpp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
