Chloride intracellular channel protein 6 (Clic6) Recombinant Protein | Clic6 recombinant protein
Recombinant Mouse Chloride intracellular channel protein 6 (Clic6)
Gene Names
Clic6; CLIC1L; AL022908; AW045520; 5730466J16Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chloride intracellular channel protein 6 (Clic6); Recombinant Mouse Chloride intracellular channel protein 6 (Clic6); Clic6 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-596aa; full length protein
Sequence
MAEATEPKEVAPGSQGQPEGATIEGPGEPGAADLEGREASEEAAEAPRDLGAGVEARASG KEEGGCGQDEGTGGAQAQDPRTGPEAETPGASGAPGEAEAAERDPEGAIPQGAEEAPSAQ QVQGMSSGLDSQGEAPEVPGDSRREPEDPTASEAGEEAESGQEAQGGGALGLQINPEVQG LAGDNMDTEAPAGGPLGSESEPQGGGESSPQPQDEAIEIVTTEIGGNESGELAGASAADA AGEGETLGKDGSEEAASEDARVDAHENGDQGKLQEETGEEEARPEPELKGPCEGAIQEKP PDGSLDGEEAKSTEHEEESQAELSNHLAEEPSVQGGEELGRVNGRRENGPALEEGDPGQE HDITLFVKAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPP FMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDA NEIYEKNLLRALKKLDSYLNSPLPDEIDADSSEDVTVSQRKFLDGDELTLADCNLLPKLH IIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADREIEHAYSDAAKRMK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Clic6 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,886 Da
NCBI Official Full Name
chloride intracellular channel protein 6
NCBI Official Synonym Full Names
chloride intracellular channel 6
NCBI Official Symbol
Clic6
NCBI Official Synonym Symbols
CLIC1L; AL022908; AW045520; 5730466J16Rik
NCBI Protein Information
chloride intracellular channel protein 6
UniProt Protein Name
Chloride intracellular channel protein 6
Protein Family
UniProt Gene Name
Clic6
UniProt Entry Name
CLIC6_MOUSE
Uniprot Description
CLIC6: May insert into membranes and form chloride ion channels. May play a critical role in water-secreting cells, possibly through the regulation of chloride ion transport. Belongs to the chloride channel CLIC family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Channel, chloride; Membrane protein, integral
Cellular Component: cytoplasm; integral to membrane; membrane; plasma membrane
Molecular Function: chloride channel activity; D2 dopamine receptor binding; D3 dopamine receptor binding; D4 dopamine receptor binding; dopamine receptor binding; protein C-terminus binding; protein homodimerization activity; voltage-gated ion channel activity
Biological Process: chloride transport; ion transport; transport
Similar Products
Product Notes
The Clic6 clic6 (Catalog #AAA7011634) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-596aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Clic6 clic6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEATEPKEV APGSQGQPEG ATIEGPGEPG AADLEGREAS EEAAEAPRDL GAGVEARASG KEEGGCGQDE GTGGAQAQDP RTGPEAETPG ASGAPGEAEA AERDPEGAIP QGAEEAPSAQ QVQGMSSGLD SQGEAPEVPG DSRREPEDPT ASEAGEEAES GQEAQGGGAL GLQINPEVQG LAGDNMDTEA PAGGPLGSES EPQGGGESSP QPQDEAIEIV TTEIGGNESG ELAGASAADA AGEGETLGKD GSEEAASEDA RVDAHENGDQ GKLQEETGEE EARPEPELKG PCEGAIQEKP PDGSLDGEEA KSTEHEEESQ AELSNHLAEE PSVQGGEELG RVNGRRENGP ALEEGDPGQE HDITLFVKAG YDGESIGNCP FSQRLFMILW LKGVIFNVTT VDLKRKPADL QNLAPGTNPP FMTFDGEVKT DVNKIEEFLE EKLVPPRYPK LGTQHPESNS AGNDVFAKFS AFIKNTKKDA NEIYEKNLLR ALKKLDSYLN SPLPDEIDAD SSEDVTVSQR KFLDGDELTL ADCNLLPKLH IIKIVAKKYR DFEFPSEMTG IWRYLNNAYA RDEFTNTCPA DREIEHAYSD AAKRMK. It is sometimes possible for the material contained within the vial of "Chloride intracellular channel protein 6 (Clic6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
