Claudin-7 (CLDN7) Recombinant Protein | CLDN7 recombinant protein

Recombinant Human Claudin-7 (CLDN7)

• Gene Names: CLDN7; CLDN-7; CEPTRL2; CPETRL2; Hs.84359; claudin-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Claudin-7 (CLDN7); Recombinant Human Claudin-7 (CLDN7); Recombinant Claudin-7 (CLDN7); Claudin-7; CLDN-7; CLDN7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-211
• Sequence: MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
• Sequence Length: 211

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 297206811
• NCBI GeneID: 1366
• NCBI Accession #: NP_001171951.1
• NCBI GenBank Nucleotide #: NM_001185022.1
• UniProt Accession #: O95471; Q6IPN3; Q7Z4Y7; Q9BVN0; B2R9X7; D3DTP0
• Molecular Weight: 22,418 Da
• NCBI Official Full Name: claudin-7 isoform 1
• NCBI Official Synonym Full Names: claudin 7
• NCBI Official Symbol: CLDN7
• NCBI Official Synonym Symbols: CLDN-7; CEPTRL2; CPETRL2; Hs.84359; claudin-1
• NCBI Protein Information: claudin-7; clostridium perfringens enterotoxin receptor-like 2
• UniProt Protein Name: Claudin-7
• Protein Family: Claudin
• UniProt Gene Name: CLDN7
• UniProt Synonym Gene Names: CEPTRL2; CPETRL2; CLDN-7
• UniProt Entry Name: CLD7_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]

Uniprot Description

Claudin-7: Plays a major role in tight junction-specific obliteration of the intercellular space. Belongs to the claudin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: tight junction; basolateral plasma membrane; integral to membrane; lateral plasma membrane

Molecular Function: identical protein binding; protein binding; structural molecule activity

Biological Process: calcium-independent cell-cell adhesion