Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Claudin-4 (CLDN4) Recombinant Protein | CLDN4 recombinant protein

Recombinant Human Claudin-4 (CLDN4)

Gene Names
CLDN4; CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Claudin-4 (CLDN4); Recombinant Human Claudin-4 (CLDN4); CLDN4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-209aa; Full length protein
Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL LCCNCPPRTDKPYSAKYSAARSAAASNYV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CLDN4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,077 Da
NCBI Official Full Name
claudin-4
NCBI Official Synonym Full Names
claudin 4
NCBI Official Symbol
CLDN4
NCBI Official Synonym Symbols
CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
NCBI Protein Information
claudin-4
UniProt Protein Name
Claudin-4
Protein Family
UniProt Gene Name
CLDN4
UniProt Synonym Gene Names
CPER; CPETR1; WBSCR8; CPE-R; CPE-receptor
UniProt Entry Name
CLD4_HUMAN

NCBI Description

The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]

Uniprot Description

Claudin-4: Plays a major role in tight junction-specific obliteration of the intercellular space. CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the claudin family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cytoskeletal

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: apical plasma membrane; apicolateral plasma membrane; basal plasma membrane; integral to plasma membrane; lateral plasma membrane; plasma membrane; tight junction

Molecular Function: identical protein binding; structural molecule activity; transmembrane receptor activity

Biological Process: calcium-independent cell-cell adhesion; circadian rhythm; female pregnancy; response to progesterone stimulus; signal transduction

Research Articles on CLDN4

Similar Products

Product Notes

The CLDN4 cldn4 (Catalog #AAA7011596) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-209aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CLDN4 cldn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASMGLQVMG IALAVLGWLA VMLCCALPMW RVTAFIGSNI VTSQTIWEGL WMNCVVQSTG QMQCKVYDSL LALPQDLQAA RALVIISIIV AALGVLLSVV GGKCTNCLED ESAKAKTMIV AGVVFLLAGL MVIVPVSWTA HNIIQDFYNP LVASGQKREM GASLYVGWAA SGLLLLGGGL LCCNCPPRTD KPYSAKYSAA RSAAASNYV. It is sometimes possible for the material contained within the vial of "Claudin-4 (CLDN4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.