Cardiotrophin-like cytokine factor 1 (CLCF1) Recombinant Protein | CLCF1 recombinant protein

Recombinant Human Cardiotrophin-like cytokine factor 1 (CLCF1)

Cat. Num. AAA1354291

• Gene Names: CLCF1; CLC; NR6; BSF3; NNT1; BSF-3; CISS2; NNT-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cardiotrophin-like cytokine factor 1 (CLCF1); Recombinant Human Cardiotrophin-like cytokine factor 1 (CLCF1); CLCF1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-225, Full length protein
• Sequence: LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
• Sequence Length: 198

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 261245022
• NCBI GeneID: 23529
• NCBI Accession #: NP_001159684.1
• NCBI GenBank Nucleotide #: NM_001166212.1
• UniProt Accession #: Q9UBD9; Q6NZA4; B4DNT4
• Molecular Weight: 24,087 Da
• NCBI Official Full Name: cardiotrophin-like cytokine factor 1 isoform 2
• NCBI Official Synonym Full Names: cardiotrophin like cytokine factor 1
• NCBI Official Symbol: CLCF1
• NCBI Official Synonym Symbols: CLC; NR6; BSF3; NNT1; BSF-3; CISS2; NNT-1
• NCBI Protein Information: cardiotrophin-like cytokine factor 1
• UniProt Protein Name: Cardiotrophin-like cytokine factor 1
• Protein Family: Cardiotrophin-like cytokine factor
• UniProt Gene Name: CLCF1
• UniProt Synonym Gene Names: BSF3; CLC; NNT1; BSF-3; NNT-1

NCBI Description

This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009]

Uniprot Description

Cytokine with B-cell stimulating capability. Binds to and activates the ILST/gp130 receptor.