Probable cytosolic iron-sulfur protein assembly protein ciao1-B (ciao1b) Recombinant Protein | ciao1b recombinant protein
Recombinant Salmo salar Probable cytosolic iron-sulfur protein assembly protein ciao1-B (ciao1b)
Gene Names
LOC106585549; CIAO1; ciao1b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable cytosolic iron-sulfur protein assembly protein ciao1-B (ciao1b); Recombinant Salmo salar Probable cytosolic iron-sulfur protein assembly protein ciao1-B (ciao1b); ciao1b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-333, Full length protein
Sequence
MNDTLALLQKFNAHPDSRCWYVAWNPKGTLLASCGGDRTIRIWGREGDSWECKTVLQDGHQRTVRKVAWSPCGNYLASASFDATTCIWKKKNDDFECLTVLEGHENEVKCVAWAPSGNLLATCSRDKSVWIWEVDEENEYECVSVVNSHTQDVKHVVWHPTQELLASCSYDNNVCVYKEEDDDWECRATLEGHTSTVWGLTFDPSGQRLASCSDDCTVKIWKECQPEGGQEGTDAAWKCVCTLSGFHGRTVYDIAWCPLTGALATACGDDGVRVFKEDETADPDQPAFSLSAHVPKAHTQDVNCIAWHPKEAGLLVSCSDNGEIAVWNYQSGV
Sequence Length
333
Species
Salmo salar (Atlantic salmon)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,038 Da
NCBI Official Full Name
probable cytosolic iron-sulfur protein assembly protein ciao1-B isoform X1
NCBI Official Symbol
LOC106585549
NCBI Official Synonym Symbols
CIAO1; ciao1b
NCBI Protein Information
probable cytosolic iron-sulfur protein assembly protein ciao1-B
UniProt Protein Name
Probable cytosolic iron-sulfur protein assembly protein ciao1-B
Protein Family
UniProt Gene Name
ciao1b
Uniprot Description
Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins.
Similar Products
Product Notes
The ciao1b ciao1b (Catalog #AAA1003047) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-333, Full length protein. The amino acid sequence is listed below: MNDTLALLQK FNAHPDSRCW YVAWNPKGTL LASCGGDRTI RIWGREGDSW ECKTVLQDGH QRTVRKVAWS PCGNYLASAS FDATTCIWKK KNDDFECLTV LEGHENEVKC VAWAPSGNLL ATCSRDKSVW IWEVDEENEY ECVSVVNSHT QDVKHVVWHP TQELLASCSY DNNVCVYKEE DDDWECRATL EGHTSTVWGL TFDPSGQRLA SCSDDCTVKI WKECQPEGGQ EGTDAAWKCV CTLSGFHGRT VYDIAWCPLT GALATACGDD GVRVFKEDET ADPDQPAFSL SAHVPKAHTQ DVNCIAWHPK EAGLLVSCSD NGEIAVWNYQ SGV. It is sometimes possible for the material contained within the vial of "Probable cytosolic iron-sulfur protein assembly protein ciao1-B (ciao1b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
