Sensor protein ChvG (chvG) Recombinant Protein | chvG recombinant protein
Recombinant Rhizobium meliloti Sensor protein ChvG (chvG)
Gene Names
chvG; exoS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sensor protein ChvG (chvG); Recombinant Rhizobium meliloti Sensor protein ChvG (chvG); Recombinant Sensor protein ChvG (chvG); Sensor protein ChvG EC= 2.7.13.3; Histidine kinase sensory protein ExoS; chvG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-577
Sequence
MRGQRRWAHPFTLIRRLFGNAVFSSLTRRIVFFNLVALVVLVGGIMYLNQFREGLIDARVESLLTQGEIIAGAISASASVDTNSITIDPEKLLELQAGESITPLPSDEDLEFPIIQERVAPVLRRLISPTRTRARLFDADADLLLDSRHLYSGGQVLRFDLPPVDPESPSLADEFGTWFNRLLQPGDLPLYKEPPGGNGSIYPEVMNALTGVRGAVVRVTEKGELIVSVAVPVQRFRAVLGVLLLSTQAGDIDKIVHAERLAIIRVFGVAALVNVILSLLLSSTIANPLRRLSAAAIRVRRGGAKEREEIPDFSSRQDEIGNLSVALREMTTALYDRIAAIENFAADVSHELKNPLTSLRSAVETLPLARNEESKKRLMDVIQHDVRRLDRLISDISDASRLDAELARADAKKVDLEKLLGDLVEISRQIRGSKKPVLLDFVVDRKDNPRASFIVSGYELRIGQIITNLIENARSFVPEQNGRIVVRLTRSRLRCIVYVEDNGPGIQAEDIDRIFERFYTDRPEGEDFGQNSGLGLSISRQIAEAHGGTLRAENIAGKDGRISGARFVLSLPAGPHP
Sequence Length
577
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63,721 Da
NCBI Official Full Name
histidine kinase sensory transmembrane protein
NCBI Official Symbol
chvG
NCBI Official Synonym Symbols
exoS
NCBI Protein Information
histidine kinase sensory transmembrane protein
UniProt Protein Name
Sensor protein ChvG
Protein Family
UniProt Gene Name
chvG
UniProt Synonym Gene Names
exoS
UniProt Entry Name
CHVG_RHIME
Uniprot Description
Function: Member of a two-component regulatory system ChvG(ExoS)/ChvI involved in regulating the production of succinoglycan. Activates ChvI by phosphorylation.
Catalytic activity: ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.
Pathway: Glycan metabolism; exopolysaccharide biosynthesis.
Subunit structure: Homodimer.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Contains 1 HAMP domain.Contains 1 histidine kinase domain.
Sequence caution: The sequence CAC41430.1 differs from that shown. Reason: Erroneous initiation.
Research Articles on chvG
Similar Products
Product Notes
The chvG chvg (Catalog #AAA1140129) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-577. The amino acid sequence is listed below: MRGQRRWAHP FTLIRRLFGN AVFSSLTRRI VFFNLVALVV LVGGIMYLNQ FREGLIDARV ESLLTQGEII AGAISASASV DTNSITIDPE KLLELQAGES ITPLPSDEDL EFPIIQERVA PVLRRLISPT RTRARLFDAD ADLLLDSRHL YSGGQVLRFD LPPVDPESPS LADEFGTWFN RLLQPGDLPL YKEPPGGNGS IYPEVMNALT GVRGAVVRVT EKGELIVSVA VPVQRFRAVL GVLLLSTQAG DIDKIVHAER LAIIRVFGVA ALVNVILSLL LSSTIANPLR RLSAAAIRVR RGGAKEREEI PDFSSRQDEI GNLSVALREM TTALYDRIAA IENFAADVSH ELKNPLTSLR SAVETLPLAR NEESKKRLMD VIQHDVRRLD RLISDISDAS RLDAELARAD AKKVDLEKLL GDLVEISRQI RGSKKPVLLD FVVDRKDNPR ASFIVSGYEL RIGQIITNLI ENARSFVPEQ NGRIVVRLTR SRLRCIVYVE DNGPGIQAED IDRIFERFYT DRPEGEDFGQ NSGLGLSISR QIAEAHGGTL RAENIAGKDG RISGARFVLS LPAGPHP. It is sometimes possible for the material contained within the vial of "Sensor protein ChvG (chvG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
