Neuronal acetylcholine receptor subunit beta-4 (CHRNB4) Recombinant Protein | CHRNB4 recombinant protein
Recombinant Chicken Neuronal acetylcholine receptor subunit beta-4 (CHRNB4)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuronal acetylcholine receptor subunit beta-4 (CHRNB4); Recombinant Chicken Neuronal acetylcholine receptor subunit beta-4 (CHRNB4); Recombinant Neuronal acetylcholine receptor subunit beta-4 (CHRNB4); Neuronal acetylcholine receptor subunit beta-4; Neuronal acetylcholine receptor non-alpha-3 chain; N-alpha 3; CHRNB4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
4-470
Sequence
ADAEEKLMNHLLSPDRYNKLIRPAVNSSQLVSIELQVSLAQLISVNEREQIMTTNVWLNQEWIDYRLAWKPSDYEGINMLRIPAKHIWLPDIVLYNNADGTYEVSLYTNAIVQNNGSIRWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKTSMASMDDFTPSGEWDIVALPGRRTENPLDPNYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKLVFLERLPAYLFMKRPENNSPRQKPANCKKTRAENLCMDPADFYKNSTYFVNTASAKKYDMKITDTLDNVSSHQDFRLRTGTKFSPEVQEAIDGVSFIAEHMKSDDNDQSVIEDWKYVAMVVDRLFLWIFVLVCVLGTVGLFLQPLFQNHIAATNP
Sequence Length
470
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
53,785 Da
NCBI Official Full Name
Neuronal acetylcholine receptor subunit beta-4
NCBI Official Symbol
CHRNB4
NCBI Protein Information
neuronal acetylcholine receptor subunit beta-4; N-alpha 3; neuronal acetylcholine receptor non-alpha-3 chain; cholinergic receptor, nicotinic, beta polypeptide 4; nicotinic acetylcholine receptor beta-4 (non-alpha-3) subunit
UniProt Protein Name
Neuronal acetylcholine receptor subunit beta-4
Protein Family
UniProt Gene Name
CHRNB4
UniProt Synonym Gene Names
N-alpha 3
UniProt Entry Name
ACHB4_CHICK
Uniprot Description
Function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subunit structure: Neuronal AChR seems to be composed of two different type of subunits: alpha and non-alpha (also called beta). A functional receptor seems to consist of two alpha-chains and three non-alpha chains.
Subcellular location: Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Developmental stage: High levels in the developing ciliary and superior cervical ganglia.
Sequence similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Beta-4/CHRNB4 sub-subfamily. [View classification]
Similar Products
Product Notes
The CHRNB4 chrnb4 (Catalog #AAA967524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-470. The amino acid sequence is listed below: ADAEEKLMNH LLSPDRYNKL IRPAVNSSQL VSIELQVSLA QLISVNEREQ IMTTNVWLNQ EWIDYRLAWK PSDYEGINML RIPAKHIWLP DIVLYNNADG TYEVSLYTNA IVQNNGSIRW LPPAIYKSAC KIEVKHFPFD QQNCTLKFRS WTYDHTEIDM VLKTSMASMD DFTPSGEWDI VALPGRRTEN PLDPNYVDVT YDFIIKRKPL FYTINLIIPC VLITSLAILV FYLPSDCGEK MTLCISVLLA LTVFLLLISK IVPPTSLDVP LIGKYLMFTM VLVTFSIVTS VCVLNVHHRS PSTHTMPPWV KLVFLERLPA YLFMKRPENN SPRQKPANCK KTRAENLCMD PADFYKNSTY FVNTASAKKY DMKITDTLDN VSSHQDFRLR TGTKFSPEVQ EAIDGVSFIA EHMKSDDNDQ SVIEDWKYVA MVVDRLFLWI FVLVCVLGTV GLFLQPLFQN HIAATNP. It is sometimes possible for the material contained within the vial of "Neuronal acetylcholine receptor subunit beta-4 (CHRNB4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
