Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuronal acetylcholine receptor subunit beta-4 (Chrnb4) Recombinant Protein | Chrnb4 recombinant protein

Recombinant Mouse Neuronal acetylcholine receptor subunit beta-4 (Chrnb4)

Gene Names
Chrnb4; Acrb4; Acrb-4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuronal acetylcholine receptor subunit beta-4 (Chrnb4); Recombinant Mouse Neuronal acetylcholine receptor subunit beta-4 (Chrnb4); Chrnb4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-495aa; full length protein
Sequence
RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWL KQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSI QWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEW DIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCG EKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHH RSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPHSSQLHLTTAEATSTSALGPS SPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSSGRFRQDLQEALEGVSFIAQH LESDDRDQSVIEDWKFVAMVVDRLFLWVFVIVCILGTMGLFLPPLFQIHAPSKGL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Chrnb4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,809 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit beta-4
NCBI Official Synonym Full Names
cholinergic receptor, nicotinic, beta polypeptide 4
NCBI Official Symbol
Chrnb4
NCBI Official Synonym Symbols
Acrb4; Acrb-4
NCBI Protein Information
neuronal acetylcholine receptor subunit beta-4
UniProt Protein Name
Neuronal acetylcholine receptor subunit beta-4
UniProt Gene Name
Chrnb4
UniProt Synonym Gene Names
Acrb4
UniProt Entry Name
ACHB4_MOUSE

Uniprot Description

nAChRB4: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Beta- 4/CHRNB4 sub-subfamily.

Protein type: Receptor, misc.; Membrane protein, multi-pass; Membrane protein, integral; Channel, cation; Channel, ligand-gated

Cellular Component: cell junction; integral to membrane; membrane; neuron projection; nicotinic acetylcholine-gated receptor-channel complex; plasma membrane; postsynaptic membrane; synapse

Molecular Function: acetylcholine binding; acetylcholine receptor activity; drug binding; extracellular ligand-gated ion channel activity; ion channel activity; nicotinic acetylcholine-activated cation-selective channel activity; protein heterodimerization activity

Biological Process: behavioral response to nicotine; ion transport; locomotory behavior; positive regulation of transmission of nerve impulse; protein heterooligomerization; regulation of action potential; regulation of membrane potential; regulation of smooth muscle contraction; response to nicotine; signal transduction; smooth muscle contraction; synaptic transmission involved in micturition; synaptic transmission, cholinergic; transport

Research Articles on Chrnb4

Similar Products

Product Notes

The Chrnb4 chrnb4 (Catalog #AAA7011462) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-495aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Chrnb4 chrnb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RLANAEEKLM DDLLNKTRYN NLIRPATSSS QLISIRLELS LSQLISVNER EQIMTTSIWL KQEWTDYRLA WNSSCYEGVN ILRIPAKRVW LPDIVLYNNA DGTYEVSVYT NVIVRSNGSI QWLPPAIYKS ACKIEVKHFP FDQQNCTLKF RSWTYDHTEI DMVLKSPTAI MDDFTPSGEW DIVALPGRRT VNPQDPSYVD VTYDFIIKRK PLFYTINLII PCVLITSLAI LVFYLPSDCG EKMTLCISVL LALTFFLLLI SKIVPPTSLD IPLIGKYLLF TMVLVTFSIV TTVCVLNVHH RSPSTHTMAS WVKECFLHKL PTFLFMKRPG LEVSPARVPH SSQLHLTTAE ATSTSALGPS SPSNLYGNSM YFVNPVPATP KSAVSSHTAG LPRDARLRSS GRFRQDLQEA LEGVSFIAQH LESDDRDQSV IEDWKFVAMV VDRLFLWVFV IVCILGTMGL FLPPLFQIHA PSKGL. It is sometimes possible for the material contained within the vial of "Neuronal acetylcholine receptor subunit beta-4 (Chrnb4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.