Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7) Recombinant Protein | CHRNA7 recombinant protein

Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial

Cat. Num. AAA9018474

• Gene Names: CHRFAM7A; D-10; CHRNA7; CHRNA7-DR1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7); Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7); partial; Neuronal acetylcholine receptor subunit alpha-7; CHRNA7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-230aa, Partial
• Sequence: GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT

• Species: Homo sapiens (Human)
• Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for CHRNA7 recombinant protein

Others

References

"Alpha-conotoxins ImI and ImII target distinct regions of the human alpha7 nicotinic acetylcholine receptor and distinguish human nicotinic receptor subtypes."Ellison M., Gao F., Wang H.L., Sine S.M., McIntosh J.M., Olivera B.M.Biochemistry 43:16019-16026(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 2506127
• NCBI GeneID: 89832
• UniProt Accession #: P36544; Q15826; Q8IUZ4; Q96RH2; Q99555; Q9BXH0; A8K7Q4; B4DFS0; Q494W8
• Molecular Weight: 502
• NCBI Official Full Name: Neuronal acetylcholine receptor subunit alpha-7
• NCBI Official Synonym Full Names: CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion
• NCBI Official Symbol: CHRFAM7A
• NCBI Official Synonym Symbols: D-10; CHRNA7; CHRNA7-DR1
• NCBI Protein Information: CHRNA7-FAM7A fusion protein; alpha-7 nicotinic cholinergic receptor subunit; alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid; CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) and FAM7A (family with sequence similari
• UniProt Protein Name: Neuronal acetylcholine receptor subunit alpha-7
• Protein Family: Neuronal acetylcholine receptor
• UniProt Gene Name: CHRNA7
• UniProt Synonym Gene Names: NACHRA7
• UniProt Entry Name: ACHA7_HUMAN

NCBI Description

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A). Alternative splicing has been observed, and two variants exist, for this hybrid gene. The N-terminally truncated products predicted by the largest open reading frames for each variant would lack the majority of the neurotransmitter-gated ion-channel ligand binding domain but retain the transmembrane region that forms the ion channel. Although current evidence supports transcription of this hybrid gene, translation of the nicotinic acetylcholine receptor-like protein-encoding open reading frames has not been confirmed. [provided by RefSeq, Jul 2008]

Uniprot Description

nAChRA7: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 7/CHRNA7 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, cation; Membrane protein, multi-pass; Channel, ligand-gated; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; plasma membrane; integral to membrane; cell junction

Molecular Function: toxin binding; chloride channel regulator activity; protein homodimerization activity; beta-amyloid binding; acetylcholine-gated cation channel activity; acetylcholine receptor activity; nicotinic acetylcholine-activated cation-selective channel activity; acetylcholine binding

Biological Process: response to nicotine; cellular calcium ion homeostasis; synaptic transmission; positive regulation of angiogenesis; activation of MAPK activity; calcium ion transport; positive regulation of cell proliferation; response to hypoxia; ion transport; negative regulation of tumor necrosis factor production; signal transduction; cognition; memory

Disease: Chromosome 15q13.3 Deletion Syndrome