Muscarinic acetylcholine receptor M5 (Chrm5) Recombinant Protein | Chrm5 recombinant protein
Recombinant Rat Muscarinic acetylcholine receptor M5 (Chrm5), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Muscarinic acetylcholine receptor M5 (Chrm5); Recombinant Rat Muscarinic acetylcholine receptor M5 (Chrm5); partial; Chrm5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
214-442, Partial, provide a part of intracellular domain.
Sequence
RIYRETEKRTKDLADLQGSDSVAEAKKREPAQRTLLRSFFSCPRPSLAQRERNQASWSSSRRSTSTTGKTTQATDLSADWEKAEQVTTCSSYPSSEDEAKPTTDPVFQMVYKSEAKESPGKESNTQETKETVVNTRTENSDYDTPKYFLSPAAAHRLKSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSFPVSKDPSTKGPDPNLSHQMTKRKRMVLVKERKAAQT
Sequence Length
442
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,137 Da
NCBI Official Full Name
muscarinic acetylcholine receptor M5
NCBI Official Synonym Full Names
cholinergic receptor, muscarinic 5
NCBI Official Symbol
Chrm5
NCBI Protein Information
muscarinic acetylcholine receptor M5
UniProt Protein Name
Muscarinic acetylcholine receptor M5
Protein Family
UniProt Gene Name
Chrm5
UniProt Synonym Gene Names
Chrm-5
NCBI Description
M5 muscarinic receptor; stimulates phosphoinositide hydrolysis without affecting adenylyl cyclase activity [RGD, Feb 2006]
Uniprot Description
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Research Articles on Chrm5
Similar Products
Product Notes
The Chrm5 chrm5 (Catalog #AAA951570) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 214-442, Partial, provide a part of intracellular domain. The amino acid sequence is listed below: RIYRETEKRT KDLADLQGSD SVAEAKKREP AQRTLLRSFF SCPRPSLAQR ERNQASWSSS RRSTSTTGKT TQATDLSADW EKAEQVTTCS SYPSSEDEAK PTTDPVFQMV YKSEAKESPG KESNTQETKE TVVNTRTENS DYDTPKYFLS PAAAHRLKSQ KCVAYKFRLV VKADGTQETN NGCRKVKIMP CSFPVSKDPS TKGPDPNLSH QMTKRKRMVL VKERKAAQT . It is sometimes possible for the material contained within the vial of "Muscarinic acetylcholine receptor M5 (Chrm5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
