Insulin receptor substrate 1 (chico) Recombinant Protein | chico recombinant protein
Recombinant Drosophila melanogaster Insulin receptor substrate 1 (chico), partial
Gene Names
chico; anon-WO0078940.1; anon-WO0078940.4; BcDNA.GH11263; BcDNA:GH11263; CG5686; chic; Chico; CHICO; dIRS; DmelCG5686; fs(2)4; fs(2)ry4; IRS; IRS/chico
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Insulin receptor substrate 1 (chico); Recombinant Drosophila melanogaster Insulin receptor substrate 1 (chico); partial; chico recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-240aa; Partial
Sequence
MASISDDGMALSGYLKKLKTMKKKFFVLYEETSTSAARLEYYDTEKKFLQRAEPKRVIYLKNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHSPYDHVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTTIRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAIATNMHNTILSAMSAKTESNTNLI
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107,832 Da
NCBI Official Full Name
chico, isoform B
NCBI Official Symbol
chico
NCBI Official Synonym Symbols
anon-WO0078940.1; anon-WO0078940.4; BcDNA.GH11263; BcDNA:GH11263; CG5686; chic; Chico; CHICO; dIRS; DmelCG5686; fs(2)4; fs(2)ry4; IRS; IRS/chico
NCBI Protein Information
CG5686 gene product from transcript CG5686-RB
UniProt Protein Name
Insulin receptor substrate 1
Protein Family
UniProt Gene Name
chico
UniProt Synonym Gene Names
IRS; dIRS
Uniprot Description
Activates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit (). May mediate the control of various cellular processes by insulin-like peptides. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains. Involved in control of cell proliferation, cell size, and body and organ growth throughout development. Also has a role in a signaling pathway controlling the physiological response required to endure periods of low nutrient conditions. Insulin/insulin-like growth factor (IGF) signaling pathway has a role in regulating aging and is necessary in the ovary for vitellogenic maturation.
Research Articles on chico
Similar Products
Product Notes
The chico chico (Catalog #AAA1317284) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-240aa; Partial. The amino acid sequence is listed below: MASISDDGMA LSGYLKKLKT MKKKFFVLYE ETSTSAARLE YYDTEKKFLQ RAEPKRVIYL KNCFNINRRL DTKHRFVIVL SSRDGGFGIV LENENDLRKW LDKLLVLQRN IANSNGTAHS PYDHVWQVVI QKKGISEKVG ITGTYHCCLT SKSLTFVCIG PEKTPNGEDR VASIEILLTT IRRCGHASPQ CIFYVELGRQ SVLGSGDLWM ETDNAAIATN MHNTILSAMS AKTESNTNLI. It is sometimes possible for the material contained within the vial of "Insulin receptor substrate 1 (chico), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
