Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cystic fibrosis transmembrane conductance regulator (Cftr) Recombinant Protein | Cftr recombinant protein

Recombinant Rat Cystic fibrosis transmembrane conductance regulator (Cftr) , partial

Gene Names
Cftr; RGD1561193
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cystic fibrosis transmembrane conductance regulator (Cftr); Recombinant Rat Cystic fibrosis transmembrane conductance regulator (Cftr); partial; Cftr recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
359-853aa; Partial
Sequence
QIWYDSLGMIRKIQDFLQTQEYKVLEYNLMFTGLVMENVTAFWEEGFQELLEKVQLNNDDRKTSNGENHLSFSHLCLVGNPVLKNINLNIKKGEMLAITGSTGAGKTSLLMLILGELEASEGIIKHSGRVSFSSQISWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQEDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEQIFESCVCKLMASKTRILVTSKMEQLKKADKILILHEGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDASTTWNKAKQSFRQTGEFGEKRKNSILSSFSSVKKISIVQKTPLSIEGESDDLQERRLSLVPDSEHGEAALPRSNMITAGPTFPGRRRQSVLDLMTFTPSSVSSSLQRTRASIRKISLAPRISLKEEDIYSRRLSQDSTLNITEEINEEDLKECFFDDMVKIPTVTTWNTYLRYFTLHRG
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
167,830 Da
NCBI Official Full Name
cystic fibrosis transmembrane conductance regulator
NCBI Official Synonym Full Names
cystic fibrosis transmembrane conductance regulator
NCBI Official Symbol
Cftr
NCBI Official Synonym Symbols
RGD1561193
NCBI Protein Information
cystic fibrosis transmembrane conductance regulator
UniProt Protein Name
Cystic fibrosis transmembrane conductance regulator
UniProt Gene Name
Cftr
UniProt Synonym Gene Names
Abcc7; CFTR

NCBI Description

cAMP-activated chloride channel and ATP binding cassette (ABC) transporter involved in intestinal anion secretion [RGD, Feb 2006]

Uniprot Description

Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis. Mediates the transport of chloride ions across the cell membrane (). Channel activity is coupled to ATP hydrolysis. The ion channel is also permeable to HCO3-; selectivity depends on the extracellular chloride concentration. Exerts its function also by modulating the activity of other ion channels and transporters. Contributes to the regulation of the pH and the ion content of the epithelial fluid layer. Modulates the activity of the epithelial sodium channel (ENaC) complex, in part by regulating the cell surface expression of the ENaC complex. May regulate bicarbonate secretion and salvage in epithelial cells by regulating the transporter SLC4A7. Can inhibit the chloride channel activity of ANO1 (). Plays a role in the chloride and bicarbonate homeostasis during sperm epididymal maturation and capacitation ().

Research Articles on Cftr

Similar Products

Product Notes

The Cftr cftr (Catalog #AAA1221097) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 359-853aa; Partial. The amino acid sequence is listed below: QIWYDSLGMI RKIQDFLQTQ EYKVLEYNLM FTGLVMENVT AFWEEGFQEL LEKVQLNNDD RKTSNGENHL SFSHLCLVGN PVLKNINLNI KKGEMLAITG STGAGKTSLL MLILGELEAS EGIIKHSGRV SFSSQISWIM PGTIKENIIF GVSYDEYRYK SVVKACQLQE DITKFAEQDN TVLGEGGVTL SGGQRARISL ARAVYKDADL YLLDSPFGYL DVLTEEQIFE SCVCKLMASK TRILVTSKME QLKKADKILI LHEGSSYFYG TFSELQSLRP DFSSKLMGYD TFDQFTEERR SSILTETLRR FSVDDASTTW NKAKQSFRQT GEFGEKRKNS ILSSFSSVKK ISIVQKTPLS IEGESDDLQE RRLSLVPDSE HGEAALPRSN MITAGPTFPG RRRQSVLDLM TFTPSSVSSS LQRTRASIRK ISLAPRISLK EEDIYSRRLS QDSTLNITEE INEEDLKECF FDDMVKIPTV TTWNTYLRYF TLHRG . It is sometimes possible for the material contained within the vial of "Cystic fibrosis transmembrane conductance regulator (Cftr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.