Complement factor I (CFI) Recombinant Protein | CFI recombinant protein
Recombinant Human Complement factor I (CFI)
Gene Names
CFI; FI; IF; KAF; AHUS3; ARMD13; C3BINA; C3b-INA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement factor I (CFI); Recombinant Human Complement factor I (CFI); CFI recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-583, Full length protein
Sequence
KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV
Sequence Length
565
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CFI recombinant protein
This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uraemic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immmune deposits is another condition associated with mutation of this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,750 Da
NCBI Official Full Name
complement factor I isoform 2 preproprotein
NCBI Official Synonym Full Names
complement factor I
NCBI Official Symbol
CFI
NCBI Official Synonym Symbols
FI; IF; KAF; AHUS3; ARMD13; C3BINA; C3b-INA
NCBI Protein Information
complement factor I
UniProt Protein Name
Complement factor I
Protein Family
UniProt Gene Name
CFI
UniProt Synonym Gene Names
IF
NCBI Description
This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uremic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immune deposits and age-related macular degeneration are other conditions associated with mutations of this gene. [provided by RefSeq, Dec 2015]
Uniprot Description
Responsible for cleaving the alpha-chains of C4b and C3b in the presence of the cofactors C4-binding protein and factor H respectively.
Research Articles on CFI
Similar Products
Product Notes
The CFI cfi (Catalog #AAA954952) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-583, Full length protein. The amino acid sequence is listed below: KVTYTSQEDL VEKKCLAKKY THLSCDKVFC QPWQRCIEGT CVCKLPYQCP KNGTAVCATN RRSFPTYCQQ KSLECLHPGT KFLNNGTCTA EGKFSVSLKH GNTDSEGIVE VKLVDQDKTM FICKSSWSMR EANVACLDLG FQQGADTQRR FKLSDLSINS TECLHVHCRG LETSLAECTF TKRRTMGYQD FADVVCYTQK ADSPMDDFFQ CVNGKYISQM KACDGINDCG DQSDELCCKA CQGKGFHCKS GVCIPSQYQC NGEVDCITGE DEVGCAGFAS VTQEETEILT ADMDAERRRI KSLLPKLSCG VKNRMHIRRK RIVGGKRAQL GDLPWQVAIK DASGITCGGI YIGGCWILTA AHCLRASKTH RYQIWTTVVD WIHPDLKRIV IEYVDRIIFH ENYNAGTYQN DIALIEMKKD GNKKDCELPR SIPACVPWSP YLFQPNDTCI VSGWGREKDN ERVFSLQWGE VKLISNCSKF YGNRFYEKEM ECAGTYDGSI DACKGDSGGP LVCMDANNVT YVWGVVSWGE NCGKPEFPGV YTKVANYFDW ISYHVGRPFI SQYNV. It is sometimes possible for the material contained within the vial of "Complement factor I (CFI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
