Complement factor D (Cfd) Recombinant Protein | Cfd recombinant protein
Recombinant Mouse Complement factor D (Cfd)
Gene Names
Cfd; DF; Adn
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement factor D (Cfd); Recombinant Mouse Complement factor D (Cfd); Cfd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-259, Full length protein
Sequence
ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS
Sequence Length
234
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cfd recombinant protein
This protein is a member of the trypsin family of peptidases. The encoded protein is a component of the alternative complement pathway best known for its role in humoral suppression of infectious agents. This protein is also a serine protease that is secreted by adipocytes into the bloodstream. Finally, the encoded protein has a high level of expression in fat, suggesting a role for adipose tissue in immune system biology.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,986 Da
NCBI Official Full Name
complement factor D isoform 2 preproprotein
NCBI Official Synonym Full Names
complement factor D (adipsin)
NCBI Official Symbol
Cfd
NCBI Official Synonym Symbols
DF; Adn
NCBI Protein Information
complement factor D
UniProt Protein Name
Complement factor D
Protein Family
UniProt Gene Name
Cfd
UniProt Synonym Gene Names
Adn; Df
NCBI Description
This gene encodes a serine protease that plays an important role in the alternative pathway of complement activation for pathogen recognition and elimination. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional enzyme that in turn cleaves factor B in the complement pathway. This gene is expressed in adipocytes and the mature enzyme is secreted into the bloodstream. Mice lacking the encoded product cannot initiate alternative pathway of complement activation. [provided by RefSeq, Jul 2016]
Uniprot Description
Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Research Articles on Cfd
Similar Products
Product Notes
The Cfd cfd (Catalog #AAA956431) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-259, Full length protein. The amino acid sequence is listed below: ILGGQEAAAH ARPYMASVQV NGTHVCGGTL LDEQWVLSAA HCMDGVTDDD SVQVLLGAHS LSAPEPYKRW YDVQSVVPHP GSRPDSLEDD LILFKLSQNA SLGPHVRPLP LQYEDKEVEP GTLCDVAGWG VVTHAGRRPD VLHQLRVSIM NRTTCNLRTY HDGVVTINMM CAESNRRDTC RGDSGSPLVC GDAVEGVVTW GSRVCGNGKK PGVYTRVSSY RMWIENITNG NMTS. It is sometimes possible for the material contained within the vial of "Complement factor D (Cfd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
