Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Centromere protein S (apitd1) Recombinant Protein | apitd1 recombinant protein

Recombinant Xenopus laevis Centromere protein S (apitd1)

Gene Names
cenps.L; mhf1; cenps; apitd1; apitd1.L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Centromere protein S (apitd1); Recombinant Xenopus laevis Centromere protein S (apitd1); apitd1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-135, Full length protein
Sequence
MAEGQEEHFSRTQRLKAAVHYVVGSLCQEVADDKEIDFSKQAIAAISEITFRQCESFAKDLEIFARHAKRTTINMDDVKLLARRSRSLYAHISKCSDEIAANSLEQKEKKKKKSVSGGNVSRNSDMDTVVPESKD
Sequence Length
135
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,179 Da
NCBI Official Full Name
centromere protein S
NCBI Official Synonym Full Names
centromere protein S L homeolog
NCBI Official Symbol
cenps.L
NCBI Official Synonym Symbols
mhf1; cenps; apitd1; apitd1.L
NCBI Protein Information
centromere protein S
UniProt Protein Name
Centromere protein S
Protein Family
UniProt Gene Name
cenps
UniProt Synonym Gene Names
apitd1; mhf1; CENP-S

Uniprot Description

DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. In complex with CENPX (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPX and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks. In complex with CENPT, CENPW and CENPX (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression. As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure. DNA-binding function is fulfilled in the presence of CENPX, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own.

Similar Products

Product Notes

The apitd1 cenps (Catalog #AAA1447515) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-135, Full length protein. The amino acid sequence is listed below: MAEGQEEHFS RTQRLKAAVH YVVGSLCQEV ADDKEIDFSK QAIAAISEIT FRQCESFAKD LEIFARHAKR TTINMDDVKL LARRSRSLYA HISKCSDEIA ANSLEQKEKK KKKSVSGGNV SRNSDMDTVV PESKD. It is sometimes possible for the material contained within the vial of "Centromere protein S (apitd1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.