Testing Data
(Fig-1: Detection of human GPC3 in the HEK293/GPC3 stable cell line by Flow Cytometry [Cell surface staining]. HEK293 cells (Green); HEK293/GPC3 cells (Red).)
GPC3 cell line
GPC3 Stable Cell Line-H
Gene Names
GPC3; SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
Applications
Functional Assay, Flow Cytometry, Functional Assay, Immunocytochemistry, Western Blot
Synonyms
GPC3; GPC3 Stable Cell Line-H; Cell Lines; Stable Cell Lines; GPC3 Stable Cell Line; hGPC3; GTR2-2; OCI-5; MXR7; Functional Assay; 14-514ACL; 14-514; GPC3 cell line
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Sequence
MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQR LQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKF LIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSD INVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQ VSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGG YCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYV QKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELI QKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHEL KMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGG SGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLT SMAISVVCFFFLVH
Sequence Length
564
Applicable Applications for GPC3 cell line
Functional Assay, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB)
Application Notes
Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C -CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Shipping Note
Product available only in the USA.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Testing Data
(Fig-1: Detection of human GPC3 in the HEK293/GPC3 stable cell line by Flow Cytometry [Cell surface staining]. HEK293 cells (Green); HEK293/GPC3 cells (Red).)
Testing Data
(Fig-1: Detection of human GPC3 in the HEK293/GPC3 stable cell line by Flow Cytometry [Cell surface staining]. HEK293 cells (Green); HEK293/GPC3 cells (Red).)
Related Product Information for GPC3 cell line
GPC3 Stable Cell Line-H is a stably transfected HEK293 cell line which expresses human Glypican 3 (GPC3, also known as GTR2-2, OCI-5 and MXR7).
Product Categories/Family for GPC3 cell line
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
glypican-3 isoform 3
NCBI Official Synonym Full Names
glypican 3
NCBI Official Symbol
GPC3
NCBI Official Synonym Symbols
SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
NCBI Protein Information
glypican-3
Protein Family
NCBI Description
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
Research Articles on GPC3
Similar Products
Product Notes
The GPC3 (Catalog #AAA669349) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GPC3 can be used in a range of immunoassay formats including, but not limited to, Functional Assay, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB). Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C -CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times. Researchers should empirically determine the suitability of the GPC3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGTVRTACL VVAMLLSLDF PGQAQPPPPP PDATCHQVRS FFQR LQPGLKWVPE TPVPGSDLQV CLPKGPTCCS RKMEEKYQLT ARLNMEQLLQ SASMELKF LIIQNAAVFQ EAFEIVVRHA KNYTNAMFKN NYPSLTPQAF EFVGEFFTDV SLYILGSD INVDDMVNEL FDSLFPVIYT QLMNPGLPDS ALDINECLRG ARRDLKVFGN FPKLIMTQ VSKSLQVTRI FLQALNLGIE VINTTDHLKF SKDCGRMLTR MWYCSYCQGL MMVKPCGG YCNVVMQGCM AGVVEIDKYW REYILSLEEL VNGMYRIYDM ENVLLGLFST IHDSIQYV QKNAGKLTTT IGKLCAHSQQ RQYRSAYYPE DLFIDKKVLK VAHVEHEETL SSRRRELI QKLKSFISFY SALPGYICSH SPVAENDTLC WNGQELVERY SQKAARNGMK NQFNLHEL KMKGPEPVVS QIIDKLKHIN QLLRTMSMPK GRVLDKNLDE EGFESGDCGD DEDECIGG SGDGMIKVKN QLRFLAELAY DLDVDDAPGN SQQATPKDNE ISTFHNLGNV HSPLKLLT SMAISVVCFF FLVH. It is sometimes possible for the material contained within the vial of "GPC3, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
