Testing Data
(Fig-1: Detection of human A2AR in the CHO-K1/A2AR stable cell line. CHO-K1 cells (Green); HEK293/A2AR (Red).)
A2AR cell line
A2AR Stable Cell Line
Gene Names
ADORA2A; A2aR; RDC8; ADORA2
Applications
Functional Assay, Flow Cytometry, Functional Assay, Immunocytochemistry, Western Blot
Synonyms
A2AR; A2AR Stable Cell Line; Cell Lines; Stable Cell Lines; ADRA2R; ADRAR; Functional Assay; 14-522; A2AR cell line
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYF VVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDR YIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPG ERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVL SHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQV SLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKG VCPEPPGLDDPLAQDGAGVS
Sequence Length
2518
Applicable Applications for A2AR cell line
Functional Assay, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB)
Application Notes
Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C -CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Shipping Note
Product available only in the USA.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Testing Data
(Fig-1: Detection of human A2AR in the CHO-K1/A2AR stable cell line. CHO-K1 cells (Green); HEK293/A2AR (Red).)
Testing Data
(Fig-1: Detection of human A2AR in the CHO-K1/A2AR stable cell line. CHO-K1 cells (Green); HEK293/A2AR (Red).)
Related Product Information for A2AR cell line
A2AR Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human adenosine A2A receptor (A2AR, also known as ADORA2A).
Product Categories/Family for A2AR cell line
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein, an adenosine receptor of A2A subtype, uses adenosine as the preferred endogenous agonist and preferentially interacts with the G(s) and G(olf) family of G proteins to increase intracellular cAMP levels. It plays an important role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as inflammatory diseases and neurodegenerative disorders. Alternative splicing results in multiple transcript variants. A read-through transcript composed of the upstream SPECC1L (sperm antigen with calponin homology and coiled-coil domains 1-like) and ADORA2A (adenosine A2a receptor) gene sequence has been identified, but it is thought to be non-coding. [provided by RefSeq, Jun 2013]
Research Articles on A2AR
Similar Products
Product Notes
The A2AR (Catalog #AAA669356) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's A2AR can be used in a range of immunoassay formats including, but not limited to, Functional Assay, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB). Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C -CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times. Researchers should empirically determine the suitability of the A2AR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPIMGSSVYI TVELAIAVLA ILGNVLVCWA VWLNSNLQNV TNYF VVSLAAADIA VGVLAIPFAI TISTGFCAAC HGCLFIACFV LVLTQSSIFS LLAIAIDR YIAIRIPLRY NGLVTGTRAK GIIAICWVLS FAIGLTPMLG WNNCGQPKEG KNHSQGCG EGQVACLFED VVPMNYMVYF NFFACVLVPL LLMLGVYLRI FLAARRQLKQ MESQPLPG ERARSTLQKE VHAAKSLAII VGLFALCWLP LHIINCFTFF CPDCSHAPLW LMYLAIVL SHTNSVVNPF IYAYRIREFR QTFRKIIRSH VLRQQEPFKA AGTSARVLAA HGSDGEQV SLRLNGHPPG VWANGSAPHP ERRPNGYALG LVSGGSAQES QGNTGLPDVE LLSHELKG VCPEPPGLDD PLAQDGAGVS. It is sometimes possible for the material contained within the vial of "A2AR, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
