Phosphatidate cytidylyltransferase (CDS1) Recombinant Protein | CDS1 recombinant protein
Recombinant Arabidopsis thaliana Phosphatidate cytidylyltransferase (CDS1)
Gene Names
CDS1; ATCDS1; CDP-diacylglycerol synthase 1; CDS1; F24O1.17; F24O1_17
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidate cytidylyltransferase (CDS1); Recombinant Arabidopsis thaliana Phosphatidate cytidylyltransferase (CDS1); Recombinant Phosphatidate cytidylyltransferase (CDS1); Phosphatidate cytidylyltransferase EC= 2.7.7.41; CDP-DAG synthase CDP-DG synthase CDP-diacylglycerol synthase; CDS CDP-diglyceride pyrophosphorylase CDP-diglyceride synthase CTP:phosphatidate cytidyly; CDS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-421
Sequence
MEEENVTSSPSTPVHRLRHRRRSNEVVTDGDKVNASPLLVNDRNKYKSFMVRTYSTLWMIGGFVLVVYMGHLYITAMVVVIQIFMAKELFNLLRKAPEDKCLPYIKQLNWHFFFTAMLFVYGRILSQRLANTMTADQFFYRLVSGLIKYHMAICYLLYIIGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIIINDIFAYIFGFFFGRTPLIKLSPKKTWEGFIGASVTTIISAFVLANILGRFPWLTCPRQDLSTGWLQCDADPLFKPEPFALPAWIPEWFPWKEMTILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYLQSFIVSQSVSVDKILDQILTNLTFEEQQALFVKLGQMLKDKLS
Sequence Length
421
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,660 Da
NCBI Official Full Name
phosphatidate cytidylyltransferase
NCBI Official Symbol
CDS1
NCBI Official Synonym Symbols
ATCDS1; CDP-diacylglycerol synthase 1; CDS1; F24O1.17; F24O1_17
NCBI Protein Information
phosphatidate cytidylyltransferase
UniProt Protein Name
Phosphatidate cytidylyltransferase
Protein Family
UniProt Gene Name
CDS1
UniProt Synonym Gene Names
CDS
UniProt Entry Name
CDS1_ARATH
NCBI Description
Encodes a CDP-diacylglycerol synthase, involved in phospholipid biosynthesis.
Uniprot Description
Function: May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.
Catalytic activity: CTP + phosphatidate = diphosphate + CDP-diacylglycerol.
Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the CDS family.
Similar Products
Product Notes
The CDS1 cds1 (Catalog #AAA1108801) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-421. The amino acid sequence is listed below: MEEENVTSSP STPVHRLRHR RRSNEVVTDG DKVNASPLLV NDRNKYKSFM VRTYSTLWMI GGFVLVVYMG HLYITAMVVV IQIFMAKELF NLLRKAPEDK CLPYIKQLNW HFFFTAMLFV YGRILSQRLA NTMTADQFFY RLVSGLIKYH MAICYLLYII GFMWFILTLK KKMYKYQFGQ YAWTHMILIV VFTQSSFTVA NIFEGIFWFL LPASLIIIND IFAYIFGFFF GRTPLIKLSP KKTWEGFIGA SVTTIISAFV LANILGRFPW LTCPRQDLST GWLQCDADPL FKPEPFALPA WIPEWFPWKE MTILPVQWHA LCLGLFASII APFGGFFASG FKRAFKIKDF GDSIPGHGGI TDRMDCQMVM AVFAYIYLQS FIVSQSVSVD KILDQILTNL TFEEQQALFV KLGQMLKDKL S. It is sometimes possible for the material contained within the vial of "Phosphatidate cytidylyltransferase (CDS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
