Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Mouse anti-Human SPTLC1 Monoclonal Antibody | anti-SPTLC1 antibody

SPTLC1 (Serine-palmitoyl-CoA Transferase 1, Serine Palmitoyltransferase 1, SPT 1, SPT1, Long Chain Base Biosynthesis Protein 1, LCB 1, LCB1) APC

Gene Names
SPTLC1; HSN1; LBC1; LCB1; SPT1; SPTI; HSAN1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPTLC1; Monoclonal Antibody; SPTLC1 (Serine-palmitoyl-CoA Transferase 1; Serine Palmitoyltransferase 1; SPT 1; SPT1; Long Chain Base Biosynthesis Protein 1; LCB 1; LCB1) APC; EC=2.3.1.50; HSAN; HSAN1; HSN1; LBC1; hLCB1; SPTI; anti-SPTLC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D11
Specificity
Recognizes human SPTLC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SPTLC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa43-143 from SPTLC1 (AAH07085) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAATLASLKKYGVGTCGPRGFYGTFE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Testing Data

(Detection limit for recombinant GST tagged SPTLC1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPTLC1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SPTLC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
16,073 Da
NCBI Official Full Name
Homo sapiens serine palmitoyltransferase, long chain base subunit 1, mRNA
NCBI Official Synonym Full Names
serine palmitoyltransferase long chain base subunit 1
NCBI Official Symbol
SPTLC1
NCBI Official Synonym Symbols
HSN1; LBC1; LCB1; SPT1; SPTI; HSAN1
NCBI Protein Information
serine palmitoyltransferase 1

NCBI Description

This gene encodes a member of the class-II pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is the long chain base subunit 1 of serine palmitoyltransferase. Serine palmitoyltransferase converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate and is the key enzyme in sphingolipid biosynthesis. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. Pseudogenes of this gene have been defined on chromosomes 1, 6, 10, and 13. [provided by RefSeq, Jul 2013]

Research Articles on SPTLC1

Similar Products

Product Notes

The SPTLC1 (Catalog #AAA6139272) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPTLC1 (Serine-palmitoyl-CoA Transferase 1, Serine Palmitoyltransferase 1, SPT 1, SPT1, Long Chain Base Biosynthesis Protein 1, LCB 1, LCB1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPTLC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPTLC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPTLC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.