Cyclin-dependent kinase 7 (Cdk7) Recombinant Protein | Cdk7 recombinant protein

Recombinant Mouse Cyclin-dependent kinase 7 (Cdk7)

Cat. Num. AAA948501

• Gene Names: Cdk7; Crk4; Cdkn7; AI323415; AI528512; C230069N13
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cyclin-dependent kinase 7 (Cdk7); Recombinant Mouse Cyclin-dependent kinase 7 (Cdk7); Cdk7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-346, Full length protein
• Sequence: AVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGVPLQHIFIAAGDDLLELIQGLFLFNPCTRTTASQALKTKYFSNRPGPTPGCQLPRPNCPVEALKEPANPTVATKRKRAEALEQGILPKKLIF
• Sequence Length: 345

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cdk7 recombinant protein

This protein is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.

NCBI and Uniprot Product Information

• NCBI GI #: 160333726
• NCBI GeneID: 12572
• NCBI Accession #: NP_034004.2
• NCBI GenBank Nucleotide #: NM_009874.3
• UniProt Accession #: Q03147; Q99KK3
• Molecular Weight: 38,968 Da
• NCBI Official Full Name: cyclin-dependent kinase 7
• NCBI Official Synonym Full Names: cyclin-dependent kinase 7
• NCBI Official Symbol: Cdk7
• NCBI Official Synonym Symbols: Crk4; Cdkn7; AI323415; AI528512; C230069N13
• NCBI Protein Information: cyclin-dependent kinase 7
• UniProt Protein Name: Cyclin-dependent kinase 7
• Protein Family: Cyclin-dependent kinase
• UniProt Gene Name: Cdk7
• UniProt Synonym Gene Names: Cak; Cdkn7; Crk4; Mo15; Mpk-7; P39 Mo15; CRK4

Uniprot Description

Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.