Cyclin-dependent kinase 5 Recombinant Protein | CDK5 recombinant protein

Recombinant Human Cyclin-dependent kinase 5

Cat. Num. AAA967565

• Gene Names: CDK5; LIS7; PSSALRE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cyclin-dependent kinase 5; Recombinant Human Cyclin-dependent kinase 5; Cell division protein kinase 5; Serine/threonine-protein kinase PSSALRE; Tau protein kinase II catalytic subunit; TPKII catalytic subunit; CDK5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-292. Full Length
• Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CDK5 recombinant protein

Proline-directed serine/threonine-protein kinase essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. Interacts with D1 and D3-type G1 cyclins. Phosphorylates SRC, NOS3, VIM/vimentin, p35/CDK5R1, MEF2A, SIPA1L1, SH3GLB1, PXN, PAK1, MCAM/MUC18, SEPT5, SYN1, DNM1, AMPH, SYNJ1, CDK16, RAC1, RHOA, CDC42, TONEBP/NFAT5, MAPT/TAU, MAP1B, histone H1, p53/TP53, HDAC1, APEX1, PTK2/FAK1, huntingtin/HTT, ATM, MAP2, NEFH and NEFM. Regulates several neuronal development and physiological processes including neuronal survival, migration and differentiation, axonal and neurite growth, synaptogenesis, oligodendrocyte differentiation, synaptic plasticity and neurotransmission, by phosphorylating key proteins. Activated by interaction with CDK5R1 (p35) and CDK5R2 (p39), especially in post-mitotic neurons, and promotes CDK5R1 (p35) expression in an autostimulation loop. Phosphorylates many downstream substrates such as Rho and Ras family small GTPases (e. g. PAK1, RAC1, RHOA, CDC42) or microtubule-binding proteins (e. g. MAPT/TAU, MAP2, MAP1B), and modulates actin dynamics to regulate neurite growth and/or spine morphogenesis. Phosphorylates also exocytosis associated proteins such as MCAM/MUC18, SEPT5, SYN1, and CDK16/PCTAIRE1 as well as endocytosis associated proteins such as DNM1, AMPH and SYNJ1 at synaptic terminals. In the mature central nervous system (CNS), regulates neurotransmitter movents by phosphorylating substrates associated with neurotransmitter release and synapse plasticity; synaptic vesicle exocytosis, vesicles fusion with the presynaptic membrane, and endocytosis. Promotes cell survival by activating anti-apoptotic proteins BCL2 and STAT3, and negatively regulating of JNK3/MAPK10 activity. Phosphorylation of p53/TP53 in response to genotoxic and oxidative stresses enhances its stabilization by preventing ubiquitin ligase-mediated proteasomal degradation, and induces transactivation of p53/TP53 target genes, thus regulating apoptosis. Phosphorylation of p35/CDK5R1 enhances its stabilization by preventing calpain-mediated proteolysis producing p25/CDK5R1 and avoiding ubiquitin ligase-mediated proteasomal degradation. During aberrant cell-cycle activity and DNA damage, p25/CDK5 activity elicits cell-cycle activity and double-strand DNA breaks that precedes neuronal death by deregulating HDAC1. DNA damage triggered phosphorylation of huntingtin/HTT in nuclei of neurons protects neurons against polyglutamine expansion as well as DNA damage mediated toxicity. Phosphorylation of PXN reduces its interaction with PTK2/FAK1 in matrix-cell focal adhesions (MCFA) during oligodendrocytes (OLs) differentiation. Negative regulator of Wnt/beta-catenin signaling pathway. Activator of the GAIT (IFN-gamma-activated inhibitor of translation) pathway, which suppresses expression of a post-transcriptional regulon of proinflammatory genes in myeloid cells; phosphorylates the linker domain of glutamyl-prolyl tRNA synthetase (EPRS) in a IFN-gamma-dependent manner, the initial event in assembly of the GAIT complex. Phosphorylation of SH3GLB1 is required for autophagy induction in starved neurons. Phosphorylation of TONEBP/NFAT5 in response to osmotic stress mediates its rapid nuclear localization. MEF2 is inactivated by phosphorylation in nucleus in response to neurotoxin, thus leading to neuronal apoptosis. APEX1 AP-endodeoxyribonuclease is repressed by phosphorylation, resulting in accumulation of DNA damage and contributing to neuronal death. NOS3 phosphorylation down regulates NOS3-derived nitrite (NO) levels. SRC phosphorylation mediates its ubiquitin-dependent degradation and thus leads to cytoskeletal reorganization. May regulate endothelial cell migration and angiogenesis via the modulation of lamellipodia formation. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution

Product Categories/Family for CDK5 recombinant protein

Cell Biology

References

A family of human cdc2-related protein kinases.Meyerson M., Enders G.H., Wu C.-L., Su L.-K., Gorka C., Nelson C., Harlow E., Tsai L.-H.EMBO J. 11:2909-2917(1992)

NCBI and Uniprot Product Information

• NCBI GI #: 256542306
• NCBI GeneID: 1020
• NCBI Accession #: NP_001157882.1
• NCBI GenBank Nucleotide #: NM_001164410.2
• UniProt Accession #: Q00535; A1XKG3
• Molecular Weight: 49.3 kDa
• NCBI Official Full Name: cyclin-dependent-like kinase 5 isoform 2
• NCBI Official Synonym Full Names: cyclin-dependent kinase 5
• NCBI Official Symbol: CDK5
• NCBI Official Synonym Symbols: LIS7; PSSALRE
• NCBI Protein Information: cyclin-dependent-like kinase 5
• UniProt Protein Name: Cyclin-dependent-like kinase 5
• Protein Family: Cyclin-dependent kinase
• UniProt Gene Name: CDK5
• UniProt Synonym Gene Names: CDKN5; TPKII catalytic subunit
• UniProt Entry Name: CDK5_HUMAN

NCBI Description

This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

CDK5: a protein kinase of the CDK family. Unlike other members of this family, it is not activated by cyclins but by p35 (CDK5R1) and p39. An important regulator of neuronal positioning during brain development. May also play a role in synaptogenesis and neurotransmission. Substrates include TAU, MAP2, NF-H and -M, Nudel, PDE6, beta-catenin, amphyphysin, dynamin I, synapsin 1, Munc-18, and NMDA receptor 2A. Plays a role in myogenesis, haematopoietic cell differentiation, spermatogenesis, insulin secretion, and lens differentiation. Implicated in the pathology of neurofibrillary tangles and formation of senile plaques, hallmarks of Alzheimer?s disease. Induces tau phosphorylation and aggregation and neurofibrillary tangle deposition and neurodegeneration in in vitro and in vivo animal models. Brain samples from Alzeimer?s pateints show elevated CDK5 activity.

Protein type: Protein kinase, CMGC; EC 2.7.11.1; Cell cycle regulation; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CMGC group; CDK family; CDK5 subfamily; CDK/CDK5 subfamily

Chromosomal Location of Human Ortholog: 7q36

Cellular Component: axon; cell junction; cell soma; cyclin-dependent protein kinase 5 activator complex; cytoplasm; cytoskeleton; cytosol; dendrite; filopodium; growth cone; lamellipodium; membrane; neuromuscular junction; nucleus; perikaryon; plasma membrane; postsynaptic density; postsynaptic membrane

Molecular Function: acetylcholine receptor activator activity; ATP binding; cyclin-dependent protein kinase activity; cytoskeletal protein binding; ephrin receptor binding; ErbB-2 class receptor binding; ErbB-3 class receptor binding; kinase activity; p53 binding; protein binding; protein kinase activity; protein kinase binding; protein serine/threonine kinase activity; tau-protein kinase activity

Biological Process: axon extension; axon guidance; behavioral response to cocaine; blood coagulation; cell cycle; cell division; cell proliferation; cell-matrix adhesion; central nervous system neuron development; cerebellar cortex formation; corpus callosum development; cortical actin cytoskeleton organization and biogenesis; dendrite morphogenesis; hippocampus development; intracellular protein transport; layer formation in the cerebral cortex; motor axon guidance; negative regulation of axon extension; negative regulation of cell cycle; negative regulation of protein export from nucleus; negative regulation of protein ubiquitination; negative regulation of proteolysis; negative regulation of synaptic plasticity; negative regulation of transcription, DNA-dependent; neurite development; neuron apoptosis; neuron differentiation; neuron migration; nucleocytoplasmic transport; oligodendrocyte differentiation; peptidyl-serine phosphorylation; peptidyl-threonine phosphorylation; phosphorylation; positive regulation of calcium ion-dependent exocytosis; positive regulation of neuron apoptosis; positive regulation of protein binding; positive regulation of protein kinase activity; protein amino acid autophosphorylation; receptor catabolic process; receptor clustering; regulation of apoptosis; regulation of cell migration; regulation of excitatory postsynaptic membrane potential; regulation of synaptic plasticity; rhythmic process; Schwann cell development; sensory perception of pain; serine phosphorylation of STAT3 protein; skeletal muscle development; synaptic transmission; synaptic transmission, dopaminergic; synaptic transmission, glutamatergic; synaptic vesicle endocytosis; synaptic vesicle exocytosis; synaptogenesis; visual learning

Disease: Lissencephaly 7 With Cerebellar Hypoplasia