Mouse NOTCH3 Monoclonal Antibody | anti-NOTCH3 antibody

NOTCH3 (Notch Homolog 3 (Drosophila), CADASIL, CASIL) (AP)

Cat. Num. AAA6163684

• Gene Names: NOTCH3; IMF2; CASIL; CADASIL
• Applications: Western Blot
• Purity: Purified
• Synonyms: NOTCH3; Monoclonal Antibody; NOTCH3 (Notch Homolog 3 (Drosophila); CADASIL; CASIL) (AP); Notch Homolog 3 (Drosophila); CASIL; anti-NOTCH3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H6
• Specificity: Recognizes NOTCH3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-NOTCH3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NOTCH3 (NP_000426, 47aa-156aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NOTCH3 is approximately 10ng/ml as a capture antibody.)

Related Product Information for anti-NOTCH3 antibody

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq]

Product Categories/Family for anti-NOTCH3 antibody

Antibodies; Notch Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 134244285
• NCBI GeneID: 4854
• NCBI Accession #: NP_000426
• NCBI GenBank Nucleotide #: NM_000435
• UniProt Accession #: Q9UM47; Q9UEB3; Q9UPL3; Q9Y6L8
• Molecular Weight: 243,631 Da
• NCBI Official Full Name: neurogenic locus notch homolog protein 3
• NCBI Official Synonym Full Names: notch 3
• NCBI Official Symbol: NOTCH3
• NCBI Official Synonym Symbols: IMF2; CASIL; CADASIL
• NCBI Protein Information: neurogenic locus notch homolog protein 3; Notch homolog 3
• UniProt Protein Name: Neurogenic locus notch homolog protein 3
• Protein Family: Neurogenic locus notch homolog protein
• UniProt Gene Name: NOTCH3
• UniProt Synonym Gene Names: Notch 3
• UniProt Entry Name: NOTC3_HUMAN

Uniprot Description

NOTCH3: Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Heterodimer of a C-terminal fragment N(TM) and a N- terminal fragment N(EC) which are probably linked by disulfide bonds. Interacts with MAML1, MAML2 and MAML3 which act as transcriptional coactivators for NOTCH3. Interacts with PSMA1. Interacts with HIF1AN. Ubiquitously expressed in fetal and adult tissues. Belongs to the NOTCH family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2-p13.1

Cellular Component: Golgi membrane; nucleoplasm; endoplasmic reticulum membrane; cytoplasm; integral to membrane; plasma membrane; extracellular region; cytosol; receptor complex; actin cytoskeleton

Molecular Function: protein binding; enzyme binding; calcium ion binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; negative regulation of neuron differentiation; regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; forebrain development; neuron fate commitment; Notch receptor processing; gene expression

Disease: Cerebral Arteriopathy, Autosomal Dominant, With Subcortical Infarcts And Leukoencephalopathy; Lateral Meningocele Syndrome; Myofibromatosis, Infantile, 2