Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2) Recombinant Protein | CDK2AP2 recombinant protein
Recombinant Bovine Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2)
Gene Names
CDK2AP2; DOC-1R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2); Recombinant Bovine Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2); CDK2AP2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-127, full length protein
Sequence
MSYKPIAPAPSSTPGSSTPGPGTPVPTAGSVPSPSGSVPGAAGPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Sequence Length
127
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,172 Da
NCBI Official Full Name
cyclin-dependent kinase 2-associated protein 2
NCBI Official Synonym Full Names
cyclin dependent kinase 2 associated protein 2
NCBI Official Symbol
CDK2AP2
NCBI Official Synonym Symbols
DOC-1R
NCBI Protein Information
cyclin-dependent kinase 2-associated protein 2
UniProt Protein Name
Cyclin-dependent kinase 2-associated protein 2
Protein Family
UniProt Gene Name
CDK2AP2
UniProt Synonym Gene Names
DOC1R; CDK2-associated protein 2; DOC-1R
Uniprot Description
Plays a role in regulating the self-renewal of embryonic stem cells (ESCs) and in maintaining cell survival during terminal differentiation of ESCs. Regulates microtubule organization of metaphase II oocytes. Inhibits cell cycle G1/S phase transition by repressing CDK2 expression and activation; represses CDK2 activation by inhibiting its interaction with cyclin E and A.
Similar Products
Product Notes
The CDK2AP2 cdk2ap2 (Catalog #AAA1396822) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-127, full length protein. The amino acid sequence is listed below: MSYKPIAPAP SSTPGSSTPG PGTPVPTAGS VPSPSGSVPG AAGPFRPLFN DFGPPSMGYV QAMKPPGAQG SQSTYTDLLS VIEEMGKEIR PTYAGSKSAM ERLKRGIIHA RALVRECLAE TERNART. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
