Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

M-phase inducer phosphatase 3 (Cdc25c) Recombinant Protein | Cdc25c recombinant protein

Recombinant Mouse M-phase inducer phosphatase 3 (Cdc25c)

Gene Names
Cdc25c; Cdc25
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
M-phase inducer phosphatase 3 (Cdc25c); Recombinant Mouse M-phase inducer phosphatase 3 (Cdc25c); Cdc25c recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-447, Full length protein
Sequence
STGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDFPESPKDKLHDSANLSILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPLDRQLTGKDFHQDLMKGIPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWEAPRTPRFRKMPGGPLTSPLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLGDQDAKGLSLRKMVPLCDMNAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPDTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDIQKRVIIVFLCEFSSERGPRMCRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQAELLSWRSQSKAQEGERQLQGQIALLVKGASPQ
Sequence Length
446
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cdc25c recombinant protein
This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,046 Da
NCBI Official Full Name
M-phase inducer phosphatase 3
NCBI Official Synonym Full Names
cell division cycle 25C
NCBI Official Symbol
Cdc25c
NCBI Official Synonym Symbols
Cdc25
NCBI Protein Information
M-phase inducer phosphatase 3
UniProt Protein Name
M-phase inducer phosphatase 3
UniProt Gene Name
Cdc25c
UniProt Synonym Gene Names
Cdc25m1

NCBI Description

This gene encodes a dual specificity phosphatase that dephosphorylates cyclin B-bound Cdk1 to trigger entry into mitosis. [provided by RefSeq, Dec 2014]

Uniprot Description

Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. Directly dephosphorylates CDK1 and activates its kinase activity. When phosphorylated, highly effective in activating G2 cells into prophase (). May be involved in regulating the proliferation of T-lymphocytes following cytokine stimulation.

Research Articles on Cdc25c

Similar Products

Product Notes

The Cdc25c cdc25c (Catalog #AAA958198) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-447, Full length protein. The amino acid sequence is listed below: STGPIPPASE EGSFVSAPSF RSKQRKILHL LLERNTSFTI RSDFPESPKD KLHDSANLSI LSGGTPKCCL DLSNLSSGEM SASPLTTSAD LEDNGSLDSS GPLDRQLTGK DFHQDLMKGI PVQLLCSTPN AMNHGHRKKI AKRSTSAHKE NINTSLKALE WEAPRTPRFR KMPGGPLTSP LCELEMKHLG SPITTVPKLS QNVKLEDQER ISEDPMECSL GDQDAKGLSL RKMVPLCDMN AIQMEEEESG SELLIGDFSK VCVLPTVPGK HPDLKYISPD TVAALLSGKF QSVIERFYII DCRYPYEYLG GHILGALNLH SQKELHEFFL RKPVVPLDIQ KRVIIVFLCE FSSERGPRMC RSLREKDRAL NQYPALYYPE LYILKGGYRD FFPEYMELCD PQSYCPMLHQ DHQAELLSWR SQSKAQEGER QLQGQIALLV KGASPQ. It is sometimes possible for the material contained within the vial of "M-phase inducer phosphatase 3 (Cdc25c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.