Cell division cycle protein 20 homolog (Cdc20) Recombinant Protein | Cdc20 recombinant protein
Recombinant Mouse Cell division cycle protein 20 homolog (Cdc20)
Gene Names
Cdc20; C87100; p55CDC; 2310042N09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cell division cycle protein 20 homolog (Cdc20); Recombinant Mouse Cell division cycle protein 20 homolog (Cdc20); Cdc20 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-499, full length protein
Sequence
MAQFVFESDLHSLLQLDAPIPNAPVARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRFIPQRSASQMEVASFLLSKENQPEDRGTPTKKEHQKAWSLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDYISSVAWIKEGNYLAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWAPLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFEMDPALRREREKASVAKSSLIHQGIR
Sequence Length
499
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cdc20 recombinant protein
CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,816 Da
NCBI Official Full Name
cell division cycle protein 20 homolog
NCBI Official Synonym Full Names
cell division cycle 20
NCBI Official Symbol
Cdc20
NCBI Official Synonym Symbols
C87100; p55CDC; 2310042N09Rik
NCBI Protein Information
cell division cycle protein 20 homolog
UniProt Protein Name
Cell division cycle protein 20 homolog
Protein Family
UniProt Gene Name
Cdc20
UniProt Synonym Gene Names
mmCdc20
Uniprot Description
Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
Research Articles on Cdc20
Similar Products
Product Notes
The Cdc20 cdc20 (Catalog #AAA1444892) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-499, full length protein. The amino acid sequence is listed below: MAQFVFESDL HSLLQLDAPI PNAPVARWQR KAKEATGPAP SPMRAANRSH SAGRTPGRTP GKSSSKVQTT PSKPGGDRFI PQRSASQMEV ASFLLSKENQ PEDRGTPTKK EHQKAWSLNL NGFDVEEAKI LRLSGKPQNA PEGYQNRLKV LYSQKATPGS SRKTCRYIPS LPDRILDAPE IRNDYYLNLV DWSSGNVLAV ALDNSVYLWN AGSGDILQLL QMEQPGDYIS SVAWIKEGNY LAVGTSNAEV QLWDVQQQKR LRNMTSHSAR VSSLSWNSYI LSSGSRSGHI HHHDVRVAEH HVATLSGHSQ EVCGLRWAPD GRHLASGGND NIVNVWPSGP GESGWAPLQT FTQHQGAVKA VAWCPWQSNI LATGGGTSDR HIRIWNVCSG ACLSAVDVHS QVCSILWSPH YKELISGHGF AQNQLVIWKY PTMAKVAELK GHTARVLGLT MSPDGATVAS AAADETLRLW RCFEMDPALR REREKASVAK SSLIHQGIR. It is sometimes possible for the material contained within the vial of "Cell division cycle protein 20 homolog (Cdc20), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
