Cell division cycle protein 16 homolog (CDC16) Recombinant Protein | CDC16 recombinant protein

Recombinant Human Cell division cycle protein 16 homolog (CDC16)

Cat. Num. AAA1482834

• Gene Names: CDC16; APC6; CUT9; ANAPC6; CDC16Hs
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cell division cycle protein 16 homolog (CDC16); Recombinant Human Cell division cycle protein 16 homolog (CDC16); CDC16 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-620, Full length protein
• Sequence: MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
• Sequence Length: 620

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CDC16 recombinant protein

This gene encodes a component protein of the APC complex, which is composed of eight proteins and functions as a protein ubiquitin ligase. The APC complex is a cyclin degradation system that governs exit from mitosis. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein and two other APC complex proteins, CDC23 and CDC27, contain a tetratricopeptide repeat (TPR), a protein domain that may be involved in protein-protein interaction. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 118402578
• NCBI GeneID: 8881
• NCBI Accession #: NP_001072113.1
• NCBI GenBank Nucleotide #: NM_001078645.2
• UniProt Accession #: Q13042; Q5T8C8; Q7Z651; Q96AE6; Q9Y564; A2A365
• Molecular Weight: 60,371 Da
• NCBI Official Full Name: cell division cycle protein 16 homolog isoform 1
• NCBI Official Synonym Full Names: cell division cycle 16
• NCBI Official Symbol: CDC16
• NCBI Official Synonym Symbols: APC6; CUT9; ANAPC6; CDC16Hs
• NCBI Protein Information: cell division cycle protein 16 homolog
• UniProt Protein Name: Cell division cycle protein 16 homolog
• Protein Family: Cell division control protein
• UniProt Gene Name: CDC16
• UniProt Synonym Gene Names: ANAPC6; APC6; CDC16Hs

NCBI Description

The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016]

Uniprot Description

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.