Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD9 antigen Recombinant Protein | CD9 recombinant protein

CD9 antigen

Gene Names
CD9; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD9 antigen; CD9 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-228aa; full length protein
Sequence
PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD9 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD9 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
928
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,416 Da
NCBI Official Full Name
CD9 antigen
NCBI Official Synonym Full Names
CD9 molecule
NCBI Official Symbol
CD9
NCBI Official Synonym Symbols
MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
NCBI Protein Information
CD9 antigen
UniProt Protein Name
CD9 antigen
Protein Family
UniProt Gene Name
CD9
UniProt Synonym Gene Names
MIC3; TSPAN29; MRP-1; Tspan-29
UniProt Entry Name
CD9_HUMAN

NCBI Description

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]

Uniprot Description

CD9: Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. Belongs to the tetraspanin (TM4SF) family.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; focal adhesion; membrane; plasma membrane; platelet alpha granule membrane

Molecular Function: protein binding

Biological Process: cell adhesion; cell motility; cell surface receptor linked signal transduction; fusion of sperm to egg plasma membrane; paranodal junction assembly; platelet degranulation; receptor internalization

Research Articles on CD9

Similar Products

Product Notes

The CD9 cd9 (Catalog #AAA7042509) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-228aa; full length protein. The amino acid sequence is listed below: PVKGGTKCIK YLLFGFNFIF WLAGIAVLAI GLWLRFDSQT KSIFEQETNN NNSSFYTGVY ILIGAGALMM LVGFLGCCGA VQESQCMLGL FFGFLLVIFA IEIAAAIWGY SHKDEVIKEV QEFYKDTYNK LKTKDEPQRE TLKAIHYALN CCGLAGGVEQ FISDICPKKD VLETFTVKSC PDAIKEVFDN KFHIIGAVGI GIAVVMIFGM IFSMILCCAI RRNREMV. It is sometimes possible for the material contained within the vial of "CD9 antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.