Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

T-cell surface glycoprotein CD8 beta chain (Cd8b) Recombinant Protein | Cd8b recombinant protein

Recombinant Mouse T-cell surface glycoprotein CD8 beta chain (Cd8b), partial

Gene Names
Cd8b1; Cd8b; Ly-3; Ly-C; Lyt-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell surface glycoprotein CD8 beta chain (Cd8b); Recombinant Mouse T-cell surface glycoprotein CD8 beta chain (Cd8b); partial; Cd8b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-175. Partial, provide the complete extracellular domain.
Sequence
LIQTPSSLLVQTNHTAKMSCEVKSISKLTSIYWLRERQDPKDKYFEFLASWSSSKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATVGSPKMVFGTGTKLTVVDVLPTTAPTKKTTLKMKKKKQCPFPHPETQKGLTCSLTT
Sequence Length
175
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,288 Da
NCBI Official Full Name
T-cell surface glycoprotein CD8 beta chain
NCBI Official Synonym Full Names
CD8 antigen, beta chain 1
NCBI Official Symbol
Cd8b1
NCBI Official Synonym Symbols
Cd8b; Ly-3; Ly-C; Lyt-3
NCBI Protein Information
T-cell surface glycoprotein CD8 beta chain
UniProt Protein Name
T-cell surface glycoprotein CD8 beta chain
UniProt Gene Name
Cd8b
UniProt Synonym Gene Names
Cd8b1; Ly-3; Lyt-3; Lyt3

Uniprot Description

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells.

Research Articles on Cd8b

Similar Products

Product Notes

The Cd8b cd8b (Catalog #AAA954743) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-175. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: LIQTPSSLLV QTNHTAKMSC EVKSISKLTS IYWLRERQDP KDKYFEFLAS WSSSKGVLYG ESVDKKRNII LESSDSRRPF LSIMNVKPED SDFYFCATVG SPKMVFGTGT KLTVVDVLPT TAPTKKTTLK MKKKKQCPFP HPETQKGLTC SLTT . It is sometimes possible for the material contained within the vial of "T-cell surface glycoprotein CD8 beta chain (Cd8b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.