CD83 recombinant protein

CD83 Recombinant Protein

Cat. Num. AAA3003719

• Gene Names: CD83; BL11; HB15
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD83; CD83 Recombinant Protein; CD83 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 387
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD83 recombinant protein

Background: CD83 is a single-transmembrane protein with a calculated molecular weight (MW) of 23 kDa, but due to heavy and differential glycosylation, its apparent MW ranges from 23 to 70 kDa. CD83 is predominantly expressed on mature dendritic cells (DCs) and has been used as a DC activation/maturation marker as its increased expression is correlated with upregulation of HLA class II antigen expression on DCs. CD83 is also expressed at a low level on lymphocytes and is upregulated upon lymphocyte activation. Thymic epithelial cells also express CD83, which is required for normal CD4+ T cell development. CD83 is also expressed as a soluble form (sCD83) that can be found in serum of healthy adults. sCD83 has been shown to negatively regulate immune response by lymphocytes.

NCBI and Uniprot Product Information

• NCBI GI #: 94421024
• NCBI GeneID: 9308
• NCBI Accession #: NP_001035370.1
• NCBI GenBank Nucleotide #: NM_001040280.1
• UniProt Accession #: Q01151; Q5THX9
• Molecular Weight: 23,042 Da
• NCBI Official Full Name: CD83 antigen isoform b
• NCBI Official Synonym Full Names: CD83 molecule
• NCBI Official Symbol: CD83
• NCBI Official Synonym Symbols: BL11; HB15
• NCBI Protein Information: CD83 antigen; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
• UniProt Protein Name: CD83 antigen
• Protein Family: CD83 antigen
• UniProt Gene Name: CD83
• UniProt Synonym Gene Names: hCD83
• UniProt Entry Name: CD83_HUMAN

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

CD83: May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p23

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Biological Process: negative regulation of interleukin-4 production; positive regulation of interleukin-2 production; defense response; positive regulation of CD4-positive, alpha beta T cell differentiation; signal transduction; response to organic cyclic substance; positive regulation of interleukin-10 production; humoral immune response