Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

CD81 antigen (CD81) Recombinant Protein | CD81 recombinant protein

Recombinant Human CD81 antigen (CD81), partial

Gene Names
CD81; S5.7; CVID6; TAPA1; TSPAN28
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD81 antigen (CD81); Recombinant Human CD81 antigen (CD81); partial; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; Tetraspanin-28; Tspan-28; CD81; CD81 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
113-201aa; Partial
Sequence
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CD81 recombinant protein
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.
Product Categories/Family for CD81 recombinant protein
References
TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
975
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.7
NCBI Official Full Name
CD81 antigen isoform 2
NCBI Official Synonym Full Names
CD81 molecule
NCBI Official Symbol
CD81
NCBI Official Synonym Symbols
S5.7; CVID6; TAPA1; TSPAN28
NCBI Protein Information
CD81 antigen
UniProt Protein Name
CD81 antigen
Protein Family
UniProt Gene Name
CD81
UniProt Synonym Gene Names
TAPA1; TSPAN28; Tspan-28
UniProt Entry Name
CD81_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

CD81: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV. Defects in CD81 are the cause of immunodeficiency common variable type 6 (CVID6); also called antibody deficiency due to CD81 defect. CVID6 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: apical plasma membrane; focal adhesion; immunological synapse; integral to plasma membrane; membrane; plasma membrane; vesicle

Molecular Function: protein binding

Biological Process: activation of MAPK activity; cell proliferation; cell surface receptor linked signal transduction; entry of virus into host cell; positive regulation of 1-phosphatidylinositol 4-kinase activity; positive regulation of B cell proliferation; positive regulation of cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription from RNA polymerase II promoter; protein localization; receptor internalization; regulation of growth; regulation of immune response; regulation of protein stability; response to wounding; virion attachment, binding of host cell surface receptor

Disease: Immunodeficiency, Common Variable, 6

Research Articles on CD81

Similar Products

Product Notes

The CD81 cd81 (Catalog #AAA958486) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 113-201aa; Partial. The amino acid sequence is listed below: FVNKDQIAKD VKQFYDQALQ QAVVDDDANN AKAVVKTFHE TLDCCGSSTL TALTTSVLKN NLCPSGSNII SNLFKEDCHQ KIDDLFSGK . It is sometimes possible for the material contained within the vial of "CD81 antigen (CD81), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.