Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD81 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human CD81 Monoclonal Antibody | anti-CD81 antibody

CD81 (CD81 Antigen, 26kD Cell Surface Protein TAPA-1, Target of the Antiproliferative Antibody 1, Tetraspanin-28, Tspan-28, TAPA1, TSPAN28) APC

Gene Names
CD81; S5.7; CVID6; TAPA1; TSPAN28
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD81; Monoclonal Antibody; CD81 (CD81 Antigen; 26kD Cell Surface Protein TAPA-1; Target of the Antiproliferative Antibody 1; Tetraspanin-28; Tspan-28; TAPA1; TSPAN28) APC; anti-CD81 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B7
Specificity
Recognizes human CD81.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CD81 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-127 from CD81 (AAH02978) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD81 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD81 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-CD81 antibody
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16kD Leu-13 protein to form a complex possibly involved in signal transduction. May acts a the viral receptor for HCV.
Product Categories/Family for anti-CD81 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
975
UniProt Accession #
Molecular Weight
25,809 Da
NCBI Official Full Name
Homo sapiens CD81 molecule, mRNA
NCBI Official Synonym Full Names
CD81 molecule
NCBI Official Symbol
CD81
NCBI Official Synonym Symbols
S5.7; CVID6; TAPA1; TSPAN28
NCBI Protein Information
CD81 antigen
UniProt Protein Name
CD81 antigen
Protein Family
UniProt Gene Name
CD81
UniProt Synonym Gene Names
TAPA1; TSPAN28; Tspan-28

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.(Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes. Associates with CLDN1 and the CLDN1-CD81 receptor complex is essential for HCV entry into host cell.

Research Articles on CD81

Similar Products

Product Notes

The CD81 cd81 (Catalog #AAA6135777) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD81 (CD81 Antigen, 26kD Cell Surface Protein TAPA-1, Target of the Antiproliferative Antibody 1, Tetraspanin-28, Tspan-28, TAPA1, TSPAN28) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD81 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD81 cd81 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD81, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.