CD48 recombinant protein

CD48 Recombinant Protein

Cat. Num. AAA3003653

• Gene Names: CD48; BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD48; CD48 Recombinant Protein; CD48 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 594
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD48 recombinant protein

Background: CD48 is a glycosylphosphatidylinositol (GPI) -anchored membrane protein of the signaling lymphocyte activation molecule (SLAM) family, also known as SLAMF2 and BLAST-1. It is constitutively expressed on most hematopoietic cells (not on neutrophils and a subset of long-term hematopoietic stem cells in mice) and can be upregulated under certain conditions like infection. Interaction with its low affinity ligand CD2 promotes adhesion and TCR signaling. Interaction with the high affinity ligand CD244 (2B4) regulates natural killer (NK) and CD8 T cell activation and cytolytic function.

NCBI and Uniprot Product Information

• NCBI GI #: 114871
• NCBI GeneID: 962
• UniProt Accession #: P09326; Q5U055; Q8MGR0
• Molecular Weight: 19,429 Da
• NCBI Official Full Name: CD48 antigen
• NCBI Official Synonym Full Names: CD48 molecule
• NCBI Official Symbol: CD48
• NCBI Official Synonym Symbols: BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
• NCBI Protein Information: CD48 antigen
• UniProt Protein Name: CD48 antigen
• Protein Family: CD48 antigen
• UniProt Gene Name: CD48
• UniProt Synonym Gene Names: BCM1; BLAST1; SLAMF2

NCBI Description

This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.