CD40 ligand (CD40LG) Recombinant Protein | CD40LG recombinant protein
Recombinant Dog CD40 ligand (CD40LG)
Gene Names
CD40LG; CD154; TNFSF5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD40 ligand (CD40LG); Recombinant Dog CD40 ligand (CD40LG); CD40LG recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-260aa; full length protein
Sequence
MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLYEDFVFMKTLQKCNKGEGSLSLLNCEEIKSQFEAFLKEIMLNNEMKKEENIAMQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLAVKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSRGSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL
Sequence Length
Full Length Protein
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD40LG
recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD40LG
recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,688 Da
NCBI Official Full Name
CD40 ligand
NCBI Official Symbol
CD40LG
NCBI Official Synonym Symbols
CD154; TNFSF5
NCBI Protein Information
CD40 ligand
UniProt Protein Name
CD40 ligand
UniProt Gene Name
CD40LG
UniProt Synonym Gene Names
CD40L; TNFSF5; CD40-L
UniProt Entry Name
CD40L_CANLF
Uniprot Description
Cytokine that binds to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching.
Similar Products
Product Notes
The CD40LG cd40lg (Catalog #AAA7042452) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-260aa; full length protein. The amino acid sequence is listed below: MIETYSQTAP RSVATGPPVS MKIFMYLLTV FLITQMIGSA LFAVYLHRRL DKIEDERNLY EDFVFMKTLQ KCNKGEGSLS LLNCEEIKSQ FEAFLKEIML NNEMKKEENI AMQKGDQDPR IAAHVISEAS SNPASVLRWA PKGYYTISSN LVSLENGKQL AVKRQGLYYV YAQVTFCSNR AASSQAPFVA SLCLHSPSGT ERVLLRAASS RGSSKPCGQQ SIHLGGVFEL HPGASVFVNV TDPSQVSHGT GFTSFGLLKL. It is sometimes possible for the material contained within the vial of "CD40 ligand (CD40LG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
