Cluster Of Differentiation 4 (CD4) Recombinant Protein | CD4 recombinant protein
Recombinant Cluster Of Differentiation 4 (CD4)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KTLV LGKEGESAEL PCESSQKKIT VFTWKFSDQR KILGQHGKGV LIRGGSPSQF DRFDSKKGAW EKGSFPLIIN KLKMEDSQTY ICELENRKEE VELWVFKVTF SPGTSLLQGQ SLTLTLDSNS KVSNPLTECK HKKGKVVSGS KVLSMSNLRV QDSDFWNCTV TLDQKKNWFG MTLSVLGFQS TAITAYKSEG ESAEFSFPLN FAEENGWGEL MWKAEKDSFF QPWISFSIKN KEVSVQKSTK DLKLQLKETL PLTLKIPQVS LQFAGSGNLT LTLDKGTLHQ EVNLVVMKVA QLNNTLTCEV MGPTSPKMRL TLKQENQEAR VSEEQKVVQV VAPETGLWQC LLSEGDKVKM DSRIQVLSRG VNQT
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
Uniprot Description
CD4: Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts. Associates with LCK. Binds to HIV-1 gp120 and to P4HB/PDI and upon HIV-1 binding to the cell membrane, is part of P4HB/PDI- CD4-CXCR4-gp120 complex. Interacts with HIV-1 Envelope polyprotein gp160 and protein Vpu. Interacts with Human Herpes virus 7 capsid proteins. Interacts with PTK2/FAK1; this interaction requires the presence of HIV-1 gp120.
Protein type: Cell surface; Membrane protein, integral
Cellular Component: endoplasmic reticulum membrane; cell surface; membrane; endoplasmic reticulum lumen; integral to membrane; plasma membrane; lipid raft; external side of plasma membrane
Molecular Function: protein binding; enzyme binding; protein homodimerization activity; zinc ion binding; coreceptor activity; glycoprotein binding; protein kinase binding
Biological Process: maintenance of cellular protein localization; T cell activation; immune system process; T cell selection; cytokine production; positive regulation of calcium-mediated signaling; defense response to Gram-negative bacterium; induction by virus of cell-cell fusion in host; positive regulation of peptidyl-tyrosine phosphorylation; cell surface receptor linked signal transduction; positive regulation of protein kinase activity; protein palmitoleylation; immune response; positive regulation of T cell activation; cell adhesion; regulation of T cell activation; T cell differentiation
Research Articles on CD4
Similar Products
Product Notes
The CD4 cd4 (Catalog #AAA2009885) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cluster Of Differentiation 4 (CD4) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CD4 cd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-KTLV LGKEGESAEL PCESSQKKIT VFTWKFSDQR KILGQHGKGV LIRGGSPSQF DRFDSKKGAW EKGSFPLIIN KLKMEDSQTY ICELENRKEE VELWVFKVTF SPGTSLLQGQ SLTLTLDSNS KVSNPLTECK HKKGKVVSGS KVLSMSNLRV QDSDFWNCTV TLDQKKNWFG MTLSVLGFQS TAITAYKSEG ESAEFSFPLN FAEENGWGEL MWKAEKDSFF QPWISFSIKN KEVSVQKSTK DLKLQLKETL PLTLKIPQVS LQFAGSGNLT LTLDKGTLHQ EVNLVVMKVA QLNNTLTCEV MGPTSPKMRL TLKQENQEAR VSEEQKVVQV VAPETGLWQC LLSEGDKVKM DSRIQVLSRG VNQT. It is sometimes possible for the material contained within the vial of "Cluster Of Differentiation 4 (CD4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.