T-cell surface glycoprotein CD3 epsilon chain Recombinant Protein | CD3E recombinant protein

T-cell surface glycoprotein CD3 epsilon chain

Cat. Num. AAA7042436

• Gene Names: CD3E; T3E; TCRE; IMD18
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: T-cell surface glycoprotein CD3 epsilon chain; CD3E recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 23-207aa; full length protein
• Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Sequence Length: Full Length Protein

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CD3E recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for CD3E recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 4502671
• NCBI GeneID: 916
• NCBI Accession #: NP_000724.1
• NCBI GenBank Nucleotide #: NM_000733.3
• UniProt Accession #: P07766; A8K997
• Molecular Weight: 23,147 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD3 epsilon chain
• NCBI Official Synonym Full Names: CD3e molecule
• NCBI Official Symbol: CD3E
• NCBI Official Synonym Symbols: T3E; TCRE; IMD18
• NCBI Protein Information: T-cell surface glycoprotein CD3 epsilon chain
• UniProt Protein Name: T-cell surface glycoprotein CD3 epsilon chain
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD3E
• UniProt Synonym Gene Names: T3E
• UniProt Entry Name: CD3E_HUMAN

NCBI Description

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3E: a T cell surface glycoprotein that is a component of the T cell antigen receptor. The recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Contains 1 immunoglobulin-like domain and 1 ITAM domain.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: external side of plasma membrane; plasma membrane; T cell receptor complex

Molecular Function: protein binding; protein heterodimerization activity; receptor signaling protein activity; SH3 domain binding

Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of T cell proliferation; regulation of immune response; signal complex assembly; T cell costimulation; T cell receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Immunodeficiency 18