CD37 recombinant protein

CD37 Recombinant Protein

Cat. Num. AAA3003600

• Gene Names: CD37; GP52-40; TSPAN26
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD37; CD37 Recombinant Protein; CD37 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 402
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD37 recombinant protein

Background: Tetra-spans transmembrane family (TSTF) members (CD9, CD37, CD53, CD63, CD81 and CD82) are cell-surface proteins that are characterized by the presence of four hydrophobic, membrane-spanning domains. TSTF members can mediate signal transduction events influencing the regulation of cell development, adhesion, activation, growth and motility. The human CD37 gene maps to chromosome 19p13.3 and encodes a 281 amino acid protein. CD37 is a cell surface glycoprotein that can complex with integrins and other TSTF proteins and may play a role in T cell-B cell interactions. CD37 is strongly expressed on normal and neoplastic mature sIg+ B cells and is detected at low levels on resting and activated T cells, neutrophils, granulocytes and monocytes. Transgenic mouse models elicit no changes in development and cellular composition of lymphoid organs where CD37 is lacking.

NCBI and Uniprot Product Information

• NCBI GI #: 91807110
• NCBI GeneID: 951
• NCBI Accession #: NP_001035120.1
• NCBI GenBank Nucleotide #: NM_001040031.1
• UniProt Accession #: P11049; Q3KPF9; B4DVC1
• Molecular Weight: 22,563 Da
• NCBI Official Full Name: leukocyte antigen CD37 isoform B
• NCBI Official Synonym Full Names: CD37 molecule
• NCBI Official Symbol: CD37
• NCBI Official Synonym Symbols: GP52-40; TSPAN26
• NCBI Protein Information: leukocyte antigen CD37
• UniProt Protein Name: Leukocyte antigen CD37
• Protein Family: Leukocyte antigen
• UniProt Gene Name: CD37
• UniProt Synonym Gene Names: TSPAN26; Tspan-26
• UniProt Entry Name: CD37_HUMAN

Uniprot Description

CD37: is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: immunological synapse; integral to plasma membrane; membrane

Molecular Function: protein binding

Biological Process: cell surface receptor linked signal transduction