CD34 recombinant protein

CD34 Recombinant Protein

Cat. Num. AAA3003592

• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD34; CD34 Recombinant Protein; CD34 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 789
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD34 recombinant protein

Background: CD34 is a type I transmembrane glycophosphoprotein expressed by hematopoietic stem/progenitor cells, vascular endothelium and some fibroblasts. CD34 expression has been the hallmark used to identify hematopoietic stem cells for many years. CD34+ hematopoietic stem cells expand and differentiate into all the lymphohematopoietic lineages upon cytokine or growth factor stimulation and lose CD34 expression upon differentiation. However, recent studies performed in various laboratories conflict with that convention. The extracellular domain of CD34 is homologous to CD43, a protein involved in cell-cell adhesion, and CD34 has been shown to function as a negative regulator of cell adhesion. CD34 associates with CrkL but not CrkII, is a substrate for PKC, and activation of PKC is coupled with surface expression of CD34.

NCBI and Uniprot Product Information

• NCBI GI #: 264769
• NCBI GeneID: 947
• UniProt Accession #: P28906; Q15970; Q15971; Q5JTA3; Q5JTA4; Q9UJB1; A8K664
• Molecular Weight: 40,716 Da
• NCBI Official Full Name: CD34
• NCBI Official Synonym Full Names: CD34 molecule
• NCBI Official Symbol: CD34
• NCBI Protein Information: hematopoietic progenitor cell antigen CD34; CD34 antigen
• UniProt Protein Name: Hematopoietic progenitor cell antigen CD34
• Protein Family: Hematopoietic progenitor cell antigen
• UniProt Gene Name: CD34
• UniProt Entry Name: CD34_HUMAN

NCBI Description

The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

CD34: Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. Belongs to the CD34 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: intercellular bridge; lysosome; integral to plasma membrane; perinuclear region of cytoplasm; cytoplasm; apical plasma membrane; basal plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: sulfate binding; carbohydrate binding; transcription factor binding

Biological Process: positive regulation of odontogenesis; regulation of immune response; negative regulation of nitric oxide biosynthetic process; glomerular filtration; cell motility involved in cell locomotion; negative regulation of blood coagulation; negative regulation of tumor necrosis factor production; signal transduction; positive regulation of interleukin-10 production; cell proliferation; cell-cell adhesion; positive regulation of angiogenesis; endothelial cell proliferation; regulation of blood pressure; tissue homeostasis; hemopoiesis; leukocyte migration