Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

CD320 antigen Recombinant Protein | CD320 recombinant protein

Recombinant Human CD320 antigen

Gene Names
CD320; 8D6; 8D6A; TCBLR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD320 antigen; Recombinant Human CD320 antigen; 8D6 antigen; FDC-signaling molecule 8D6; FDC-SM-8D6; Transcobalamin receptor; TCblR; CD320; CD320 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
36-231aa; Partial
Sequence
SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
Sequence Length
240
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CD320 recombinant protein
Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.
Product Categories/Family for CD320 recombinant protein
References
Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.1 kDa
NCBI Official Full Name
CD320 antigen isoform 2
NCBI Official Synonym Full Names
CD320 molecule
NCBI Official Symbol
CD320
NCBI Official Synonym Symbols
8D6; 8D6A; TCBLR
NCBI Protein Information
CD320 antigen
UniProt Protein Name
CD320 antigen
Protein Family
UniProt Gene Name
CD320
UniProt Synonym Gene Names
8D6A; FDC-SM-8D6; TCblR
UniProt Entry Name
CD320_HUMAN

NCBI Description

This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011]

Uniprot Description

CD320: Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC); also called methylmalonic aciduria due to transcobalamin receptor defect. MMATC is a metabolic disorder characterized by increased blood C3- acylcarnitine levels, elevated methylmalonate and homocysteine, and low uptake of transcobalamin-bound cobalamin, but normal conversion to adenosylcobalamin and methylcobalamin. Plasma vitamin B12 and total homocysteine are normal.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: endoplasmic reticulum; endosome membrane; integral to membrane; membrane; plasma membrane

Molecular Function: cobalamin binding; growth factor activity

Biological Process: cobalamin metabolic process; regulation of cell growth; regulation of vitamin metabolic process; vitamin metabolic process; water-soluble vitamin metabolic process

Disease: Methylmalonic Aciduria Due To Transcobalamin Receptor Defect

Research Articles on CD320

Similar Products

Product Notes

The CD320 cd320 (Catalog #AAA717382) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-231aa; Partial. The amino acid sequence is listed below: SPLSTPTSAQ AAGPSSGSCP PTKFQCRTSG LCVPLTWRCD RDLDCSDGSD EEECRIEPCT QKGQCPPPPG LPCPCTGVSD CSGGTDKKLR NCSRLACLAG ELRCTLSDDC IPLTWRCDGH PDCPDSSDEL GCGTNEILPE GDATTMGPPV TLESVTSLRN ATTMGPPVTL ESVPSVGNAT SSSAGDQSGS PTAYGV. It is sometimes possible for the material contained within the vial of "CD320 antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.