Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Signal transducer CD24 Recombinant Protein | CD24 recombinant protein

Recombinant Human Signal transducer CD24

Gene Names
CD24; CD24A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal transducer CD24; Recombinant Human Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen; CD24; CD24 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-80aa; Full Length of Mature Protein
Sequence
SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CD24 recombinant protein
Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.
Product Categories/Family for CD24 recombinant protein
References
CD24, a signal transducer modulating B cell activation responses, is a very short peptide with a glycosyl phosphatidylinositol membrane anchor.Kay R., Rosten P.M., Humphries R.K.J. Immunol. 147:1412-1416(1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.3 kDa
NCBI Official Full Name
signal transducer CD24 isoform a preproprotein
NCBI Official Synonym Full Names
CD24 molecule
NCBI Official Symbol
CD24
NCBI Official Synonym Symbols
CD24A
NCBI Protein Information
signal transducer CD24
UniProt Protein Name
Signal transducer CD24
Protein Family
UniProt Gene Name
CD24
UniProt Synonym Gene Names
CD24A
UniProt Entry Name
CD24_HUMAN

NCBI Description

This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Uniprot Description

CD24: Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. Genetic variations in CD24 are associated with susceptibility to multiple sclerosis (MS). A multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheat, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease. Polymorphisms in CD24 may act as a genetic modifier for susceptibility and progression of MS in some populations, perhaps by affecting the efficiency of CD24 expression on the cell surface. Belongs to the CD24 family.

Protein type: Cell development/differentiation; Membrane protein, GPI anchor; Cell surface; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: anchored to external side of plasma membrane; cell surface; cytosol; intracellular; lipid raft; membrane

Molecular Function: protein binding; protein kinase binding; protein tyrosine kinase activator activity; signal transducer activity

Biological Process: axon guidance; B cell receptor transport into lipid raft; cell activation; cell migration; cell-cell adhesion; chemokine receptor transport out of lipid raft; cholesterol homeostasis; elevation of cytosolic calcium ion concentration; immune response-regulating cell surface receptor signaling pathway; negative regulation of transforming growth factor-beta3 production; positive regulation of activated T cell proliferation; positive regulation of MAP kinase activity; regulation of cytokine and chemokine mediated signaling pathway; regulation of epithelial cell differentiation; regulation of MAPKKK cascade; regulation of phosphorylation; respiratory burst; response to estrogen stimulus; response to hypoxia; response to molecule of bacterial origin; T cell costimulation; Wnt receptor signaling pathway

Disease: Multiple Sclerosis, Susceptibility To

Research Articles on CD24

Similar Products

Product Notes

The CD24 cd24 (Catalog #AAA717414) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-80aa; Full Length of Mature Protein. The amino acid sequence is listed below: SETTTGTSSN SSQSTSNTGL APNPTNATTK AAGGALQSTA SLFVVSLSLL HLYS. It is sometimes possible for the material contained within the vial of "Signal transducer CD24, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.