Images
Mouse anti-Human, Rat ELAVL4 Monoclonal Antibody | anti-ELAVL4 antibody
ELAVL4 (ELAV-like Protein 4, Hu-antigen D, HuD, Paraneoplastic Encephalomyelitis Antigen HuD, HUD, PNEM)
Gene Names
ELAVL4; HUD; PNEM
Reactivity
Human, Rat
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
PurifiedPurified.
Synonyms
ELAVL4; Monoclonal Antibody; ELAVL4 (ELAV-like Protein 4; Hu-antigen D; HuD; Paraneoplastic Encephalomyelitis Antigen HuD; HUD; PNEM); Anti -ELAVL4 (ELAV-like Protein 4; anti-ELAVL4 antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1, k
Clone Number
6B9
Specificity
Recognizes human ELAVL4. Species Crossreactivity: rat.
Purity/Purification
Purified
Purified.
Purified.
Form/Format
Supplied as a liquid in PBS, pH 7.4.
Concentration
0.5mg/ml (varies by lot)
Sequence
VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Applicable Applications for anti-ELAVL4 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Immunohistochemistry (paraffin), and Western Blot.
Immunogen
Partial recombinant protein corresponding to aa312-380 from human ELAVL4 with GST tag. MW of GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Images
Images
Product Categories/Family for anti-ELAVL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
ELAV-like protein 4 isoform 5
NCBI Official Synonym Full Names
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
NCBI Official Symbol
ELAVL4
NCBI Official Synonym Symbols
HUD; PNEM
NCBI Protein Information
ELAV-like protein 4; hu-antigen D; OTTHUMP00000009609; OTTHUMP00000009610; OTTHUMP00000009611; OTTHUMP00000009612; OTTHUMP00000009613; OTTHUMP00000009614; paraneoplastic encephalomyelitis antigen HuD; Embryonic lethal, abnormal vision, Drosophila, homolog of, like-4
UniProt Protein Name
ELAV-like protein 4
Protein Family
UniProt Gene Name
ELAVL4
UniProt Synonym Gene Names
HUD; PNEM
UniProt Entry Name
ELAV4_HUMAN
Uniprot Description
ELAVL4: May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. Belongs to the RRM elav family. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA-binding
Chromosomal Location of Human Ortholog: 1p34
Molecular Function: mRNA 3'-UTR binding; RNA binding; nucleotide binding; AU-rich element binding
Biological Process: RNA processing; mRNA processing
Research Articles on ELAVL4
Similar Products
Product Notes
The ELAVL4 elavl4 (Catalog #AAA609266) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELAVL4 (ELAV-like Protein 4, Hu-antigen D, HuD, Paraneoplastic Encephalomyelitis Antigen HuD, HUD, PNEM) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELAVL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Immunohistochemistry (paraffin), and Western Blot. Researchers should empirically determine the suitability of the ELAVL4 elavl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLWQLFGPFG AVNNVKVIRD FNTNKCKGFG FVTMTNYDEA AMAIASLNGY RLGDRVLQVS FKTNKAHKS. It is sometimes possible for the material contained within the vial of "ELAVL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
