Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

(Rhesus macaque) CD226 antigen (CD226) Recombinant Protein | CD226 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) CD226 antigen (CD226)

Gene Names
CD226; PTA1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) CD226 antigen (CD226); Recombinant Macaca mulatta (Rhesus macaque) CD226 antigen (CD226); Recombinant (Rhesus macaque) CD226 antigen (CD226); CD226 antigen; Platelet and T-cell activation antigen 1 CD_antigen= CD226; CD226 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-254
Sequence
EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKIQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRFVT
Sequence Length
336
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,532 Da
NCBI Official Full Name
CD226 antigen
NCBI Official Symbol
CD226
NCBI Official Synonym Symbols
PTA1
NCBI Protein Information
CD226 antigen; platelet and T cell activation antigen 1; platelet and T-cell activation antigen 1
UniProt Protein Name
CD226 antigen
Protein Family
UniProt Gene Name
CD226
UniProt Synonym Gene Names
PTA1
UniProt Entry Name
CD226_MACMU

Uniprot Description

Function: Receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell

By similarity.

Subunit structure: Interacts with PVR and PVRL2

By similarity.

Subcellular location: Membrane; Single-pass type I membrane protein

Potential.

Post-translational modification: Phosphorylated

By similarity.

Sequence similarities: Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Similar Products

Product Notes

The CD226 cd226 (Catalog #AAA1241133) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-254. The amino acid sequence is listed below: EEVLWHTSVP FAENMSLECV YPSVGILTQV EWFKIGTEKD SIAIFSPTHG MVIRKPYAER VYFLNSTMAS NNMTLFFRNA SEDDVGYYSC SLYTYPQGTW QKVIQVVQSD GFEAAVPPNS HIVSEPGKNI TLTCQPQMTW PVQEVRWEKI QPHQIDLLTY CDLVHGRNFT SKFPRQIVSN CSHGSWSFIV VPDVTASDSG LYRCHLQASA GENETFVMRL TVAEGQTDNQ YTRFVT. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) CD226 antigen (CD226), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.