CD209 antigen (CD209) Recombinant Protein | CD209 recombinant protein
Recombinant Hylobates syndactylus CD209 antigen (CD209), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD209 antigen (CD209); Recombinant Hylobates syndactylus CD209 antigen (CD209); partial; CD209 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
59-381, provide the complete extracellular domain.
Sequence
QVSKFPSSISQEQSKQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTRLKAAVGELPEKSQQQEIYQELTRLKAAVGELPEKSTQQEIYQELTRLKATIGELPEQSKLQEIHQELTQLKAAVGELPEKSKQQEIYQELTQLKAAVGELPEKSKQQEIYXELTRLKAAVERLCRPCPWEWTFFQGNCYFMSNSQRDWQDSVTACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFAWMGLSDVNQEGTWQWVDGSPLSPSFKHYWNRGEPNNIGEEDCAEFSGNGWNDDKCNHAKFWICKMSAASCSRDEEQFLSPAPATPNPPPA
Sequence Length
381
Species
Hylobates syndactylus (Siamang) (Symphalangus syndactylus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
43,030 Da
NCBI Official Full Name
CD209 antigen
UniProt Protein Name
CD209 antigen
Protein Family
UniProt Gene Name
CD209
UniProt Synonym Gene Names
DC-SIGN1
Uniprot Description
Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens ().
Similar Products
Product Notes
The CD209 cd209 (Catalog #AAA1293239) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 59-381, provide the complete extracellular domain. The amino acid sequence is listed below: QVSKFPSSIS QEQSKQDAIY QNLTQLKAAV GELSEKSKLQ EIYQELTRLK AAVGELPEKS QQQEIYQELT RLKAAVGELP EKSTQQEIYQ ELTRLKATIG ELPEQSKLQE IHQELTQLKA AVGELPEKSK QQEIYQELTQ LKAAVGELPE KSKQQEIYXE LTRLKAAVER LCRPCPWEWT FFQGNCYFMS NSQRDWQDSV TACQEVGAQL VVIKSAEEQN FLQLQSSRSN RFAWMGLSDV NQEGTWQWVD GSPLSPSFKH YWNRGEPNNI GEEDCAEFSG NGWNDDKCNH AKFWICKMSA ASCSRDEEQF LSPAPATPNP PPA . It is sometimes possible for the material contained within the vial of "CD209 antigen (CD209), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
