Cell surface glycoprotein CD200 receptor 3 (Cd200r3) Recombinant Protein | Cd200r3 recombinant protein
Recombinant Mouse Cell surface glycoprotein CD200 receptor 3 (Cd200r3), partial
Gene Names
Cd200r3; AI505817; BB106877; mCD200RLb; 4733401I18Rik; 4833409J19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cell surface glycoprotein CD200 receptor 3 (Cd200r3); Recombinant Mouse Cell surface glycoprotein CD200 receptor 3 (Cd200r3); partial; Cd200r3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-245. Partial, provide the complete extracellular domain.
Sequence
SVKGREEIPPDDSFPFSDDNIFPDGVGVTMEIEIITPVSVQIGIKAQLFCHPSPSKEATLRIWEITPRDWPSCRLPYRAELQQISKKICTERGTTRVPAHHQSSDLPIKSMALKHDGHYSCRIETTDGIFQERHSIQVPGENRTVVCEAIASKPAMQILWTPDEDCVTKSKSHNDTMIVRSKCHREKNNGHSVFCFISHLTDNWILSMEQNRGTTSILPS
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,805 Da
NCBI Official Full Name
cell surface glycoprotein CD200 receptor 3 isoform 1
NCBI Official Synonym Full Names
CD200 receptor 3
NCBI Official Symbol
Cd200r3
NCBI Official Synonym Symbols
AI505817; BB106877; mCD200RLb; 4733401I18Rik; 4833409J19Rik
NCBI Protein Information
cell surface glycoprotein CD200 receptor 3
UniProt Protein Name
Cell surface glycoprotein CD200 receptor 3
Protein Family
UniProt Gene Name
Cd200r3
UniProt Synonym Gene Names
Cd200rlb; CD200 receptor-like 3; CD200RLb
Uniprot Description
According to PubMed:15187158 isoform 4 is a receptor for the CD200 cell surface glycoprotein. According to PubMed:16081818 isoform 4 is not a receptor for the CD200/OX2 cell surface glycoprotein. Isoform 1, isoform 2 and isoform 3 are involved in the recruitment or surface expression of the TYROBP receptor. Isoform 6, isoform 7 and isoform 8 are not involved in the recruitment or surface expression of the TYROBP receptor.
Research Articles on Cd200r3
Similar Products
Product Notes
The Cd200r3 cd200r3 (Catalog #AAA1431055) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-245. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: SVKGREEIPP DDSFPFSDDN IFPDGVGVTM EIEIITPVSV QIGIKAQLFC HPSPSKEATL RIWEITPRDW PSCRLPYRAE LQQISKKICT ERGTTRVPAH HQSSDLPIKS MALKHDGHYS CRIETTDGIF QERHSIQVPG ENRTVVCEAI ASKPAMQILW TPDEDCVTKS KSHNDTMIVR SKCHREKNNG HSVFCFISHL TDNWILSMEQ NRGTTSILPS . It is sometimes possible for the material contained within the vial of "Cell surface glycoprotein CD200 receptor 3 (Cd200r3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
