SDS-Page
CD200 recombinant protein
CD200, human recombinant
Gene Names
CD200; MRC; MOX1; MOX2; OX-2
Purity
>=90% by SDS-PAGE
Synonyms
CD200; human recombinant; CD200 molecule; MOX1; MOX2; MRC; OX-2; CD200 recombinant protein
Host
E Coli
Purity/Purification
>=90% by SDS-PAGE
Form/Format
Liquid. 1mg/ml in 20mM Tris-HCl buffer (pH8.0) containing 0.4M Urea.
Concentration
1mg/ml (varies by lot)
Sequence
MGSSHHHHHHSSGLVPRGSHMGSQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Gene Source
Human
Endotoxin
<1.0 EU per 1 microgram of protein
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Store at -80 degree C.
Centrifuge the vial prior to opening.
Shipping: Dry Ice
Shelf life: ~12 months
Centrifuge the vial prior to opening.
Shipping: Dry Ice
Shelf life: ~12 months
SDS-Page
SDS-Page
Related Product Information for CD200 recombinant protein
CD200 is a type-1 membrane glycoprotein, which contains two immunoglobulin domains, and thus belongs to the immunoglobulin superfamily. Studies of the related genes in mouse and rat suggest that this gene may regulate myeloid cell activity and delivers an inhibitory signal for the macrophage lineage in diverse tissues. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. Recombinant human CD200 protein, fused to His-tag at N-terminus, was expressed in E Coli. May regulate myeloid cell activity
Product Categories/Family for CD200 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
32,975 Da
NCBI Official Full Name
OX-2 membrane glycoprotein
NCBI Official Synonym Full Names
CD200 molecule
NCBI Official Symbol
CD200
NCBI Official Synonym Symbols
MRC; MOX1; MOX2; OX-2
NCBI Protein Information
OX-2 membrane glycoprotein
UniProt Protein Name
OX-2 membrane glycoprotein
Protein Family
UniProt Gene Name
CD200
UniProt Synonym Gene Names
MOX1; MOX2
NCBI Description
This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Uniprot Description
Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
Research Articles on CD200
Similar Products
Product Notes
The CD200 cd200 (Catalog #AAA847116) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MGSQVQVVTQ DEREQLYTPA SLKCSLQNAQ EALIVTWQKK KAVSPENMVT FSENHGVVIQ PAYKDKINIT QLGLQNSTIT FWNITLEDEG CYMCLFNTFG FGKISGTACL TVYVQPIVSL HYKFSEDHLN ITCSATARPA PMVFWKVPRS GIENSTVTLS HPNGTTSVTS ILHIKDPKNQ VGKEVICQVL HLGTVTDFKQ TVNKG. It is sometimes possible for the material contained within the vial of "CD200, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
